BLASTX nr result
ID: Atractylodes22_contig00000655
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00000655 (274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519895.1| BRASSINOSTEROID INSENSITIVE 1-associated rec... 79 3e-13 ref|XP_002303477.1| predicted protein [Populus trichocarpa] gi|2... 79 3e-13 ref|XP_002326596.1| predicted protein [Populus trichocarpa] gi|2... 79 3e-13 ref|NP_001239788.1| LRR receptor-like serine/threonine-protein k... 79 4e-13 ref|NP_001241081.1| LRR receptor-like serine/threonine-protein k... 79 4e-13 >ref|XP_002519895.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, putative [Ricinus communis] gi|223540941|gb|EEF42499.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, putative [Ricinus communis] Length = 596 Score = 79.3 bits (194), Expect = 3e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -3 Query: 269 QCVSSSPEDRPTMHRVVQTLESEVMTPCPSDFYDSTSD 156 QCVSSSPEDRPTMHRVVQ LESEVMTPCPSDFYDS+SD Sbjct: 559 QCVSSSPEDRPTMHRVVQLLESEVMTPCPSDFYDSSSD 596 >ref|XP_002303477.1| predicted protein [Populus trichocarpa] gi|222840909|gb|EEE78456.1| predicted protein [Populus trichocarpa] Length = 305 Score = 79.3 bits (194), Expect = 3e-13 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = -3 Query: 269 QCVSSSPEDRPTMHRVVQTLESEVMTPCPSDFYDSTSD 156 QCVSSSPEDRPTMHRVVQ LESEVMTPCPSDFYDS SD Sbjct: 268 QCVSSSPEDRPTMHRVVQVLESEVMTPCPSDFYDSNSD 305 >ref|XP_002326596.1| predicted protein [Populus trichocarpa] gi|222833918|gb|EEE72395.1| predicted protein [Populus trichocarpa] Length = 305 Score = 79.3 bits (194), Expect = 3e-13 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = -3 Query: 269 QCVSSSPEDRPTMHRVVQTLESEVMTPCPSDFYDSTSD 156 QCVSSSPEDRPTMHRVVQ LESEVMTPCPSDFYDS SD Sbjct: 268 QCVSSSPEDRPTMHRVVQVLESEVMTPCPSDFYDSNSD 305 >ref|NP_001239788.1| LRR receptor-like serine/threonine-protein kinase FEI 1 precursor [Glycine max] gi|223452450|gb|ACM89552.1| leucine-rich repeat transmembrane protein kinase [Glycine max] Length = 590 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -3 Query: 272 IQCVSSSPEDRPTMHRVVQTLESEVMTPCPSDFYDSTSD 156 IQCVSSSPEDRPTMHRVVQ LESEV+TPCPSDFYDS SD Sbjct: 552 IQCVSSSPEDRPTMHRVVQLLESEVVTPCPSDFYDSNSD 590 >ref|NP_001241081.1| LRR receptor-like serine/threonine-protein kinase FEI 1-like precursor [Glycine max] gi|223452298|gb|ACM89477.1| leucine-rich repeat transmembrane protein kinase [Glycine max] Length = 547 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -3 Query: 272 IQCVSSSPEDRPTMHRVVQTLESEVMTPCPSDFYDSTSD 156 IQCVSSSPEDRPTMHRVVQ LESEV+TPCPSDFYDS SD Sbjct: 509 IQCVSSSPEDRPTMHRVVQLLESEVVTPCPSDFYDSNSD 547