BLASTX nr result
ID: Atractylodes22_contig00000634
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00000634 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAY26021.2| cinnamyl alcohol dehydrogenase [Eucommia ulmoides] 91 1e-16 ref|XP_002513513.1| cinnamoyl-CoA reductase, putative [Ricinus c... 90 2e-16 gb|ADO51749.1| cinnamyl alcohol dehydrogenase [Camellia sinensis] 89 3e-16 gb|AAX15956.1| cinnamyl alcohol dehydrogenase 1 [Nicotiana tabacum] 89 4e-16 ref|XP_003633515.1| PREDICTED: bifunctional dihydroflavonol 4-re... 88 8e-16 >gb|AAY26021.2| cinnamyl alcohol dehydrogenase [Eucommia ulmoides] Length = 322 Score = 90.5 bits (223), Expect = 1e-16 Identities = 41/45 (91%), Positives = 45/45 (100%) Frame = -2 Query: 137 MSGAGKTVCVTGASGYIASWLVKFLLQRGYTVKASVRDPNDPKKT 3 MSGAGKTVCVTGASG+IASW+VKFLLQRGYTV+A+VRDPNDPKKT Sbjct: 1 MSGAGKTVCVTGASGFIASWIVKFLLQRGYTVRATVRDPNDPKKT 45 >ref|XP_002513513.1| cinnamoyl-CoA reductase, putative [Ricinus communis] gi|223547421|gb|EEF48916.1| cinnamoyl-CoA reductase, putative [Ricinus communis] Length = 402 Score = 89.7 bits (221), Expect = 2e-16 Identities = 47/66 (71%), Positives = 50/66 (75%), Gaps = 3/66 (4%) Frame = -2 Query: 191 QVPLTNPHTSTLVASSEKMS---GAGKTVCVTGASGYIASWLVKFLLQRGYTVKASVRDP 21 Q L S L E+MS G GKTVCVTGASGYIASW+VKFLLQRGYTVKASVRDP Sbjct: 59 QSKLIADSNSLLQHEEEEMSSDSGEGKTVCVTGASGYIASWIVKFLLQRGYTVKASVRDP 118 Query: 20 NDPKKT 3 NDP+KT Sbjct: 119 NDPRKT 124 >gb|ADO51749.1| cinnamyl alcohol dehydrogenase [Camellia sinensis] Length = 324 Score = 89.4 bits (220), Expect = 3e-16 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -2 Query: 137 MSGAGKTVCVTGASGYIASWLVKFLLQRGYTVKASVRDPNDPKKT 3 MSG GKTVCVTGASGYIASWLVK LLQRGYTVKASVRDP+DPKKT Sbjct: 1 MSGVGKTVCVTGASGYIASWLVKLLLQRGYTVKASVRDPSDPKKT 45 >gb|AAX15956.1| cinnamyl alcohol dehydrogenase 1 [Nicotiana tabacum] Length = 327 Score = 89.0 bits (219), Expect = 4e-16 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -2 Query: 137 MSGAGKTVCVTGASGYIASWLVKFLLQRGYTVKASVRDPNDPKKT 3 MS A KTVCVTGASGYIASWLVKFLLQRGYTVKASVRDPNDPKKT Sbjct: 1 MSLAAKTVCVTGASGYIASWLVKFLLQRGYTVKASVRDPNDPKKT 45 >ref|XP_003633515.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase-like [Vitis vinifera] gi|296085368|emb|CBI29100.3| unnamed protein product [Vitis vinifera] Length = 323 Score = 87.8 bits (216), Expect = 8e-16 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = -2 Query: 137 MSGAGKTVCVTGASGYIASWLVKFLLQRGYTVKASVRDPNDPKKT 3 MSG GK VCVTGASGYIASWLVK LLQRGYTVKA+VRDPNDPKKT Sbjct: 1 MSGQGKVVCVTGASGYIASWLVKLLLQRGYTVKATVRDPNDPKKT 45