BLASTX nr result
ID: Atractylodes22_contig00000549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00000549 (212 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFB83199.1| fructan-fructan 1-fructosyltransferase [Cichorium... 86 3e-15 gb|AAD00558.1| fructan-fructan 1-fructosyltransferase [Cichorium... 86 4e-15 emb|CAA04120.2| fructan fructan 1-fructosyltransferase [Cynara c... 82 6e-14 dbj|BAJ24841.1| fructan:fructan 1-fructosyltransferase [Arctium ... 81 8e-14 emb|CAH18891.1| 2,1-fructan:2,1-fructan 1-fructosyltransferase p... 76 2e-12 >gb|AFB83199.1| fructan-fructan 1-fructosyltransferase [Cichorium intybus] Length = 622 Score = 85.9 bits (211), Expect = 3e-15 Identities = 46/77 (59%), Positives = 59/77 (76%), Gaps = 7/77 (9%) Frame = +3 Query: 3 PPPAPVRKRLGIRVLSTITFVSLCFVLAFILIVV--RDQHDSTANSALPEIP-----SLQ 161 PPPA V+K+ ++VLS+IT VS+ FVLAF+LIV+ +D ++TANSALPE P S Q Sbjct: 25 PPPAAVKKQSFVKVLSSITLVSVFFVLAFVLIVLNQQDSTNATANSALPEAPVPEKSSAQ 84 Query: 162 TSAADRLTWERTAFHFQ 212 S +DRLTWERTA+HFQ Sbjct: 85 RSQSDRLTWERTAYHFQ 101 >gb|AAD00558.1| fructan-fructan 1-fructosyltransferase [Cichorium intybus] Length = 617 Score = 85.5 bits (210), Expect = 4e-15 Identities = 45/72 (62%), Positives = 56/72 (77%), Gaps = 2/72 (2%) Frame = +3 Query: 3 PPPAPVRKRLGIRVLSTITFVSLCFVLAFILIVV--RDQHDSTANSALPEIPSLQTSAAD 176 PPPA V+K+ +RVLS+IT VSL FVLAF+LIV+ +D ++TAN ALPE S Q +D Sbjct: 25 PPPAAVKKQSFVRVLSSITLVSLFFVLAFVLIVLNQQDSTNATANLALPEKSSAQHYQSD 84 Query: 177 RLTWERTAFHFQ 212 RLTWERTA+HFQ Sbjct: 85 RLTWERTAYHFQ 96 >emb|CAA04120.2| fructan fructan 1-fructosyltransferase [Cynara cardunculus var. scolymus] Length = 617 Score = 81.6 bits (200), Expect = 6e-14 Identities = 49/73 (67%), Positives = 53/73 (72%), Gaps = 3/73 (4%) Frame = +3 Query: 3 PPPAPVRKRLGIRVLSTITFVSLCFVLAFILIVVRDQHDSTA---NSALPEIPSLQTSAA 173 PPPA VR RL IRV S+IT VSL FV AF+LI++ QHDST NSA E S Q SAA Sbjct: 25 PPPAAVRNRLLIRVSSSITLVSLFFVSAFLLILLY-QHDSTYTDDNSAPSESSSQQPSAA 83 Query: 174 DRLTWERTAFHFQ 212 DRL WERTAFHFQ Sbjct: 84 DRLRWERTAFHFQ 96 >dbj|BAJ24841.1| fructan:fructan 1-fructosyltransferase [Arctium lappa] Length = 617 Score = 81.3 bits (199), Expect = 8e-14 Identities = 47/73 (64%), Positives = 57/73 (78%), Gaps = 3/73 (4%) Frame = +3 Query: 3 PPPAPVRKRLGIRVLSTITFVSLCFVLAFILIVVRDQHDST---ANSALPEIPSLQTSAA 173 PPPA V KRL IRVLS+ITFVSL FV AF+LI++ +QH+S+ N A + S+Q SAA Sbjct: 25 PPPATVSKRLLIRVLSSITFVSLFFVSAFLLILL-NQHESSYTDDNLAPLDRSSVQPSAA 83 Query: 174 DRLTWERTAFHFQ 212 +RLTWERTAFHFQ Sbjct: 84 ERLTWERTAFHFQ 96 >emb|CAH18891.1| 2,1-fructan:2,1-fructan 1-fructosyltransferase precursor [Echinops ritro] Length = 608 Score = 76.3 bits (186), Expect = 2e-12 Identities = 43/69 (62%), Positives = 51/69 (73%) Frame = +3 Query: 6 PPAPVRKRLGIRVLSTITFVSLCFVLAFILIVVRDQHDSTANSALPEIPSLQTSAADRLT 185 PPA V RL IRVLSTIT VSL FV AF+L++ +Q DS N+ LP+ P Q SAADRL Sbjct: 22 PPAAVSHRLLIRVLSTITVVSLFFVAAFLLVL--NQQDS-GNNPLPQDPPPQPSAADRLR 78 Query: 186 WERTAFHFQ 212 WERTA+H+Q Sbjct: 79 WERTAYHYQ 87