BLASTX nr result
ID: Atractylodes22_contig00000007
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00000007 (645 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282402.1| PREDICTED: translocon at the outer membrane ... 114 2e-23 ref|XP_002530483.1| amidase, putative [Ricinus communis] gi|2235... 112 6e-23 ref|XP_002317872.1| amidase family protein [Populus trichocarpa]... 107 2e-21 ref|XP_003530960.1| PREDICTED: glutamyl-tRNA(Gln) amidotransfera... 107 2e-21 ref|XP_004160411.1| PREDICTED: translocon at the outer membrane ... 106 3e-21 >ref|XP_002282402.1| PREDICTED: translocon at the outer membrane of chloroplasts 64 [Vitis vinifera] gi|297734325|emb|CBI15572.3| unnamed protein product [Vitis vinifera] Length = 590 Score = 114 bits (285), Expect = 2e-23 Identities = 55/60 (91%), Positives = 60/60 (100%) Frame = +3 Query: 3 CTKAIDLDKKNVKAYLRRGTAREMLGYYKEAIEDFRYALVLEPTNKRAAVSADRLKKLFQ 182 CT+AI+LDKKNVKAYLRRGTAREMLGYYK+AIEDFRYALVLEPTNKRA++SADRLKKLFQ Sbjct: 531 CTEAINLDKKNVKAYLRRGTAREMLGYYKDAIEDFRYALVLEPTNKRASLSADRLKKLFQ 590 >ref|XP_002530483.1| amidase, putative [Ricinus communis] gi|223529980|gb|EEF31906.1| amidase, putative [Ricinus communis] Length = 589 Score = 112 bits (280), Expect = 6e-23 Identities = 53/60 (88%), Positives = 60/60 (100%) Frame = +3 Query: 3 CTKAIDLDKKNVKAYLRRGTAREMLGYYKEAIEDFRYALVLEPTNKRAAVSADRLKKLFQ 182 CTKAI+LDKKNVKAYLRRGTAREM+GYYKEAIEDF+YALVLEPTNKRAA+SA+RL+K+FQ Sbjct: 530 CTKAINLDKKNVKAYLRRGTAREMIGYYKEAIEDFQYALVLEPTNKRAALSAERLRKMFQ 589 >ref|XP_002317872.1| amidase family protein [Populus trichocarpa] gi|222858545|gb|EEE96092.1| amidase family protein [Populus trichocarpa] Length = 593 Score = 107 bits (267), Expect = 2e-21 Identities = 50/59 (84%), Positives = 59/59 (100%) Frame = +3 Query: 3 CTKAIDLDKKNVKAYLRRGTAREMLGYYKEAIEDFRYALVLEPTNKRAAVSADRLKKLF 179 C+KAI+LDKKNVKAYLRRGTAREMLGYYK+AIEDF+YALVLEPTNKRA++SA+RL+K+F Sbjct: 531 CSKAINLDKKNVKAYLRRGTAREMLGYYKDAIEDFKYALVLEPTNKRASLSAERLRKVF 589 >ref|XP_003530960.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like [Glycine max] Length = 591 Score = 107 bits (266), Expect = 2e-21 Identities = 51/60 (85%), Positives = 57/60 (95%) Frame = +3 Query: 3 CTKAIDLDKKNVKAYLRRGTAREMLGYYKEAIEDFRYALVLEPTNKRAAVSADRLKKLFQ 182 CTKAI LDKKNVKAY RRGTAREMLGYYKEAI+DF++ALVLEPTNKRAA +A+RL+KLFQ Sbjct: 532 CTKAISLDKKNVKAYFRRGTAREMLGYYKEAIDDFKHALVLEPTNKRAASAAERLRKLFQ 591 >ref|XP_004160411.1| PREDICTED: translocon at the outer membrane of chloroplasts 64-like [Cucumis sativus] Length = 591 Score = 106 bits (265), Expect = 3e-21 Identities = 50/59 (84%), Positives = 58/59 (98%) Frame = +3 Query: 3 CTKAIDLDKKNVKAYLRRGTAREMLGYYKEAIEDFRYALVLEPTNKRAAVSADRLKKLF 179 C+KAIDLDKKNVK+YLRRGTAREMLG+YKEAIEDF +ALVLEPTNKRA++SA+RL+KLF Sbjct: 531 CSKAIDLDKKNVKSYLRRGTAREMLGFYKEAIEDFSHALVLEPTNKRASISAERLRKLF 589