BLASTX nr result
ID: Atractylodes21_contig00054893
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00054893 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ34304.1| unnamed protein product [Thellungiella halophila] 59 5e-07 ref|XP_002864302.1| membrane-associated mannitol-induced [Arabid... 59 5e-07 gb|AAB41326.1| membrane associated protein [Arabidopsis thaliana] 58 9e-07 ref|NP_568804.1| membrane-associated mannitol-induced protein [A... 58 9e-07 ref|XP_002525766.1| structural molecule, putative [Ricinus commu... 57 2e-06 >dbj|BAJ34304.1| unnamed protein product [Thellungiella halophila] Length = 271 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 265 PKVVGQGLVIDEWKERREKYLARQQVGAVD 176 P+VVG+GLVIDEWKERREKYLARQQV A+D Sbjct: 239 PRVVGEGLVIDEWKERREKYLARQQVEAID 268 >ref|XP_002864302.1| membrane-associated mannitol-induced [Arabidopsis lyrata subsp. lyrata] gi|297310137|gb|EFH40561.1| membrane-associated mannitol-induced [Arabidopsis lyrata subsp. lyrata] Length = 269 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 265 PKVVGQGLVIDEWKERREKYLARQQVGAVD 176 P+VVG+GLVIDEWKERREKYLARQQV A+D Sbjct: 237 PRVVGEGLVIDEWKERREKYLARQQVEAID 266 >gb|AAB41326.1| membrane associated protein [Arabidopsis thaliana] Length = 265 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 265 PKVVGQGLVIDEWKERREKYLARQQVGAVD 176 P+VVG+GLVIDEWKERREKYLARQQV +VD Sbjct: 233 PRVVGEGLVIDEWKERREKYLARQQVESVD 262 >ref|NP_568804.1| membrane-associated mannitol-induced protein [Arabidopsis thaliana] gi|122237442|sp|Q1ECE0.1|VAP41_ARATH RecName: Full=Vesicle-associated protein 4-1; AltName: Full=Plant VAP homolog 4-1; Short=AtPVA41; AltName: Full=Protein MEMBRANE-ASSOCIATED MANNITOL-INDUCED; Short=AtMAMI; AltName: Full=VAMP-associated protein 4-1 gi|107738368|gb|ABF83684.1| At5g54110 [Arabidopsis thaliana] gi|332009069|gb|AED96452.1| membrane-associated mannitol-induced protein [Arabidopsis thaliana] Length = 266 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 265 PKVVGQGLVIDEWKERREKYLARQQVGAVD 176 P+VVG+GLVIDEWKERREKYLARQQV +VD Sbjct: 234 PRVVGEGLVIDEWKERREKYLARQQVESVD 263 >ref|XP_002525766.1| structural molecule, putative [Ricinus communis] gi|223534916|gb|EEF36602.1| structural molecule, putative [Ricinus communis] Length = 131 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 265 PKVVGQGLVIDEWKERREKYLARQQVGAVD 176 P+VVG+GLVIDEWKERREKYLARQ+V A+D Sbjct: 100 PRVVGEGLVIDEWKERREKYLARQKVEAID 129