BLASTX nr result
ID: Atractylodes21_contig00054829
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00054829 (318 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003608599.1| Lipase [Medicago truncatula] gi|355509654|gb... 41 8e-06 ref|XP_003621036.1| Lipase [Medicago truncatula] gi|124360696|gb... 41 8e-06 >ref|XP_003608599.1| Lipase [Medicago truncatula] gi|355509654|gb|AES90796.1| Lipase [Medicago truncatula] Length = 528 Score = 40.8 bits (94), Expect(2) = 8e-06 Identities = 21/37 (56%), Positives = 23/37 (62%), Gaps = 6/37 (16%) Frame = +2 Query: 2 FAGQRVKNLRFKERCEELG------ENSKNPIIKLPG 94 F G RV NL FK+RCEELG N +PI KLPG Sbjct: 341 FGGPRVGNLEFKKRCEELGVKVLRISNVNDPITKLPG 377 Score = 33.5 bits (75), Expect(2) = 8e-06 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 9/32 (28%) Frame = +3 Query: 99 IIFNETFRA---------WRCDCYAHVATELV 167 ++FNE FR W C CYAHV EL+ Sbjct: 378 VVFNENFRVLMGGRYEFPWSCSCYAHVGVELM 409 >ref|XP_003621036.1| Lipase [Medicago truncatula] gi|124360696|gb|ABN08685.1| Peptidase S26A, signal peptidase I; Esterase/lipase/thioesterase; Lipase, class 3 [Medicago truncatula] gi|355496051|gb|AES77254.1| Lipase [Medicago truncatula] Length = 506 Score = 40.8 bits (94), Expect(2) = 8e-06 Identities = 21/37 (56%), Positives = 23/37 (62%), Gaps = 6/37 (16%) Frame = +2 Query: 2 FAGQRVKNLRFKERCEELG------ENSKNPIIKLPG 94 F G RV NL FK+RCEELG N +PI KLPG Sbjct: 341 FGGPRVGNLEFKKRCEELGVKVLRISNVNDPITKLPG 377 Score = 33.5 bits (75), Expect(2) = 8e-06 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 9/32 (28%) Frame = +3 Query: 99 IIFNETFRA---------WRCDCYAHVATELV 167 ++FNE FR W C CYAHV EL+ Sbjct: 378 VVFNENFRVLMGGRYEFPWSCSCYAHVGVELM 409