BLASTX nr result
ID: Atractylodes21_contig00054518
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00054518 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAP47024.1|AF375965_1 bell-like homeodomain protein 1, partia... 56 3e-06 ref|XP_002281033.1| PREDICTED: BEL1-like homeodomain protein 11 ... 56 3e-06 emb|CAN65695.1| hypothetical protein VITISV_001986 [Vitis vinifera] 56 3e-06 ref|XP_002510447.1| bel1 homeotic protein, putative [Ricinus com... 54 1e-05 >gb|AAP47024.1|AF375965_1 bell-like homeodomain protein 1, partial [Solanum lycopersicum] Length = 393 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = -1 Query: 169 TESLSISIGSLRYLKPTQSLLEEIVSVGGKDLDSNNESYARK 44 TES +IG+ +YLKPTQSLLEE+V +GGK +DS+NE + R+ Sbjct: 112 TESFVSAIGNSKYLKPTQSLLEELVCIGGKTIDSSNEKFIRR 153 >ref|XP_002281033.1| PREDICTED: BEL1-like homeodomain protein 11 [Vitis vinifera] gi|302142555|emb|CBI19758.3| unnamed protein product [Vitis vinifera] Length = 470 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = -1 Query: 181 TFYATESLSISIGSLRYLKPTQSLLEEIVSVGGKDLDSNNESY 53 T Y TES ++G+ RYL+PTQSLLEE+V+ GGK +D +NE Y Sbjct: 177 TSYGTESFVNAVGNSRYLRPTQSLLEEVVNAGGKAIDLSNEKY 219 >emb|CAN65695.1| hypothetical protein VITISV_001986 [Vitis vinifera] Length = 533 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = -1 Query: 181 TFYATESLSISIGSLRYLKPTQSLLEEIVSVGGKDLDSNNESY 53 T Y TES ++G+ RYL+PTQSLLEE+V+ GGK +D +NE Y Sbjct: 160 TSYGTESFVNAVGNSRYLRPTQSLLEEVVNAGGKAIDLSNEKY 202 >ref|XP_002510447.1| bel1 homeotic protein, putative [Ricinus communis] gi|223551148|gb|EEF52634.1| bel1 homeotic protein, putative [Ricinus communis] Length = 469 Score = 54.3 bits (129), Expect = 1e-05 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = -1 Query: 181 TFYATESLSISIGSLRYLKPTQSLLEEIVSVGGKDLDSNNESYARK 44 T Y TES +I+I + RYLKP Q LLEEIV+V GK + NNE Y K Sbjct: 178 TSYGTESFAIAIKNSRYLKPAQMLLEEIVTVSGKATEINNEKYVGK 223