BLASTX nr result
ID: Atractylodes21_contig00054354
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00054354 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511146.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 ref|XP_002321717.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 gb|ABK93232.1| unknown [Populus trichocarpa] 56 3e-06 >ref|XP_002511146.1| conserved hypothetical protein [Ricinus communis] gi|223550261|gb|EEF51748.1| conserved hypothetical protein [Ricinus communis] Length = 177 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = -2 Query: 307 SIVEELKHDDLEGNEEVNLPAEELNKLADDFIARINRQRRIEAK 176 S V E + +DL+G EE++LPAEELNK ADDFIAR+NRQR EA+ Sbjct: 130 SEVAEKEREDLDGEEEISLPAEELNKRADDFIARVNRQRMQEAR 173 >ref|XP_002321717.1| predicted protein [Populus trichocarpa] gi|222868713|gb|EEF05844.1| predicted protein [Populus trichocarpa] Length = 203 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -2 Query: 289 KHDDLEGNEEVNLPAEELNKLADDFIARINRQRRIEAK 176 + +DLEG EE +LP EEL K ADDFIAR+NRQR +EA+ Sbjct: 160 EREDLEGEEEFSLPTEELKKRADDFIARVNRQRMLEAR 197 >gb|ABK93232.1| unknown [Populus trichocarpa] Length = 203 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -2 Query: 289 KHDDLEGNEEVNLPAEELNKLADDFIARINRQRRIEAK 176 + +DLEG EE +LP EEL K ADDFIAR+NRQR +EA+ Sbjct: 160 EREDLEGEEEFSLPTEELKKRADDFIARVNRQRMLEAR 197