BLASTX nr result
ID: Atractylodes21_contig00053857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00053857 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002304776.1| predicted protein [Populus trichocarpa] gi|2... 101 7e-20 ref|XP_002335295.1| predicted protein [Populus trichocarpa] gi|2... 101 7e-20 ref|XP_002268927.1| PREDICTED: myosin heavy chain kinase B [Viti... 99 4e-19 emb|CAN67368.1| hypothetical protein VITISV_021843 [Vitis vinifera] 99 4e-19 ref|XP_002297770.1| predicted protein [Populus trichocarpa] gi|2... 97 1e-18 >ref|XP_002304776.1| predicted protein [Populus trichocarpa] gi|222842208|gb|EEE79755.1| predicted protein [Populus trichocarpa] Length = 389 Score = 101 bits (251), Expect = 7e-20 Identities = 55/79 (69%), Positives = 61/79 (77%), Gaps = 6/79 (7%) Frame = -3 Query: 220 SPATSHRFIPYKIP-KTPPSCS-----SYRSLSVLTGHDGSVSCLAICGEFILSASHGKD 59 SPATS RF + ++ PS S SYR L+VL+GH GSVSCLA+CGEFILSAS GKD Sbjct: 15 SPATSFRFELQDVGCRSYPSKSLSGAYSYRPLAVLSGHVGSVSCLALCGEFILSASQGKD 74 Query: 58 IIVWQQPDLRQFTKFGQGD 2 IIVWQQPDLR FTKFGQGD Sbjct: 75 IIVWQQPDLRMFTKFGQGD 93 >ref|XP_002335295.1| predicted protein [Populus trichocarpa] gi|222833244|gb|EEE71721.1| predicted protein [Populus trichocarpa] Length = 172 Score = 101 bits (251), Expect = 7e-20 Identities = 55/79 (69%), Positives = 61/79 (77%), Gaps = 6/79 (7%) Frame = -3 Query: 220 SPATSHRFIPYKIP-KTPPSCS-----SYRSLSVLTGHDGSVSCLAICGEFILSASHGKD 59 SPATS RF + ++ PS S SYR L+VL+GH GSVSCLA+CGEFILSAS GKD Sbjct: 40 SPATSFRFELQDVGCRSYPSKSLSGAYSYRPLAVLSGHVGSVSCLALCGEFILSASQGKD 99 Query: 58 IIVWQQPDLRQFTKFGQGD 2 IIVWQQPDLR FTKFGQGD Sbjct: 100 IIVWQQPDLRMFTKFGQGD 118 >ref|XP_002268927.1| PREDICTED: myosin heavy chain kinase B [Vitis vinifera] gi|296081304|emb|CBI17748.3| unnamed protein product [Vitis vinifera] Length = 397 Score = 99.0 bits (245), Expect = 4e-19 Identities = 47/66 (71%), Positives = 55/66 (83%), Gaps = 1/66 (1%) Frame = -3 Query: 196 IPYKIPKTPP-SCSSYRSLSVLTGHDGSVSCLAICGEFILSASHGKDIIVWQQPDLRQFT 20 + Y++ P SY+SL+VL+GH GSVSCLA+CGEFILSAS GKDIIVWQQPDLRQFT Sbjct: 37 VEYQLSSVPVCGLPSYKSLAVLSGHVGSVSCLALCGEFILSASQGKDIIVWQQPDLRQFT 96 Query: 19 KFGQGD 2 KFGQG+ Sbjct: 97 KFGQGE 102 >emb|CAN67368.1| hypothetical protein VITISV_021843 [Vitis vinifera] Length = 399 Score = 99.0 bits (245), Expect = 4e-19 Identities = 47/66 (71%), Positives = 55/66 (83%), Gaps = 1/66 (1%) Frame = -3 Query: 196 IPYKIPKTPP-SCSSYRSLSVLTGHDGSVSCLAICGEFILSASHGKDIIVWQQPDLRQFT 20 + Y++ P SY+SL+VL+GH GSVSCLA+CGEFILSAS GKDIIVWQQPDLRQFT Sbjct: 39 VEYQLSSVPVCGLPSYKSLAVLSGHVGSVSCLALCGEFILSASQGKDIIVWQQPDLRQFT 98 Query: 19 KFGQGD 2 KFGQG+ Sbjct: 99 KFGQGE 104 >ref|XP_002297770.1| predicted protein [Populus trichocarpa] gi|222845028|gb|EEE82575.1| predicted protein [Populus trichocarpa] Length = 391 Score = 97.4 bits (241), Expect = 1e-18 Identities = 52/78 (66%), Positives = 57/78 (73%), Gaps = 5/78 (6%) Frame = -3 Query: 220 SPATSHRF----IPYKIP-KTPPSCSSYRSLSVLTGHDGSVSCLAICGEFILSASHGKDI 56 SPA S RF + Y P K+ SYR L+VL+ H G VSCLA+CGEFILSAS GKDI Sbjct: 19 SPAISFRFELQDVKYDYPSKSLSGAYSYRPLAVLSDHVGPVSCLALCGEFILSASQGKDI 78 Query: 55 IVWQQPDLRQFTKFGQGD 2 IVWQQPDLR FTKFGQGD Sbjct: 79 IVWQQPDLRLFTKFGQGD 96