BLASTX nr result
ID: Atractylodes21_contig00053836
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00053836 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACY01928.1| hypothetical protein [Beta vulgaris] 60 1e-07 gb|AEV42261.1| hypothetical protein [Beta vulgaris] 57 2e-06 >gb|ACY01928.1| hypothetical protein [Beta vulgaris] Length = 1583 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = +2 Query: 65 PAAKPMGEI*RLSGKELQQ*RENGLCFWCDEK*EMGHRC*KRD 193 P AKP GEI RLS KELQ RE+GLCF CDEK +GHRC K++ Sbjct: 326 PIAKPFGEIRRLSEKELQYKREHGLCFRCDEKWAIGHRCKKKE 368 >gb|AEV42261.1| hypothetical protein [Beta vulgaris] Length = 1396 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = +2 Query: 65 PAAKPMGEI*RLSGKELQQ*RENGLCFWCDEK*EMGHRC*K 187 P A+P GEI RLS KELQ RE GLCF CD+K +GHRC K Sbjct: 283 PIARPYGEIRRLSEKELQHKRERGLCFRCDDKWSVGHRCKK 323