BLASTX nr result
ID: Atractylodes21_contig00053794
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00053794 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281787.1| PREDICTED: potassium channel AKT1-like [Viti... 149 2e-34 emb|CBI28150.3| unnamed protein product [Vitis vinifera] 149 2e-34 emb|CAN80462.1| hypothetical protein VITISV_015412 [Vitis vinifera] 149 2e-34 emb|CAZ64538.1| inward rectifying shaker-like K+ channel [Vitis ... 149 3e-34 ref|XP_002529373.1| Potassium channel AKT1, putative [Ricinus co... 142 2e-32 >ref|XP_002281787.1| PREDICTED: potassium channel AKT1-like [Vitis vinifera] Length = 872 Score = 149 bits (377), Expect = 2e-34 Identities = 68/83 (81%), Positives = 75/83 (90%) Frame = +1 Query: 1 PLSIIDNIVNGFFAIDIILTFFVAYLDKNTYLLVDNPKQIAWRYTSTWLAFDIVSTIPSE 180 PLSI DN+VNGFFA+DI+LTFFVAYLDK TYLLVDNPKQIAW+YTSTWLAFD++STIPSE Sbjct: 93 PLSITDNVVNGFFAVDIVLTFFVAYLDKTTYLLVDNPKQIAWKYTSTWLAFDVISTIPSE 152 Query: 181 LARKISTGSLQSYGLFNMCRLWR 249 LARKI+ QSYG FNM RLWR Sbjct: 153 LARKITPSPFQSYGFFNMLRLWR 175 >emb|CBI28150.3| unnamed protein product [Vitis vinifera] Length = 872 Score = 149 bits (377), Expect = 2e-34 Identities = 68/83 (81%), Positives = 75/83 (90%) Frame = +1 Query: 1 PLSIIDNIVNGFFAIDIILTFFVAYLDKNTYLLVDNPKQIAWRYTSTWLAFDIVSTIPSE 180 PLSI DN+VNGFFA+DI+LTFFVAYLDK TYLLVDNPKQIAW+YTSTWLAFD++STIPSE Sbjct: 93 PLSITDNVVNGFFAVDIVLTFFVAYLDKTTYLLVDNPKQIAWKYTSTWLAFDVISTIPSE 152 Query: 181 LARKISTGSLQSYGLFNMCRLWR 249 LARKI+ QSYG FNM RLWR Sbjct: 153 LARKITPSPFQSYGFFNMLRLWR 175 >emb|CAN80462.1| hypothetical protein VITISV_015412 [Vitis vinifera] Length = 840 Score = 149 bits (377), Expect = 2e-34 Identities = 68/83 (81%), Positives = 75/83 (90%) Frame = +1 Query: 1 PLSIIDNIVNGFFAIDIILTFFVAYLDKNTYLLVDNPKQIAWRYTSTWLAFDIVSTIPSE 180 PLSI DN+VNGFFA+DI+LTFFVAYLDK TYLLVDNPKQIAW+YTSTWLAFD++STIPSE Sbjct: 72 PLSITDNVVNGFFAVDIVLTFFVAYLDKTTYLLVDNPKQIAWKYTSTWLAFDVISTIPSE 131 Query: 181 LARKISTGSLQSYGLFNMCRLWR 249 LARKI+ QSYG FNM RLWR Sbjct: 132 LARKITPSPFQSYGFFNMLRLWR 154 >emb|CAZ64538.1| inward rectifying shaker-like K+ channel [Vitis vinifera] Length = 872 Score = 149 bits (375), Expect = 3e-34 Identities = 68/83 (81%), Positives = 75/83 (90%) Frame = +1 Query: 1 PLSIIDNIVNGFFAIDIILTFFVAYLDKNTYLLVDNPKQIAWRYTSTWLAFDIVSTIPSE 180 PLSI DN+VNGFFA+DI+LTFFVAYLDK TYLLVDNPKQIAW+YTSTWLAFD++STIPSE Sbjct: 93 PLSITDNVVNGFFAVDIVLTFFVAYLDKTTYLLVDNPKQIAWKYTSTWLAFDVISTIPSE 152 Query: 181 LARKISTGSLQSYGLFNMCRLWR 249 LARKI+ QSYG FNM RLWR Sbjct: 153 LARKITPSPFQSYGSFNMLRLWR 175 >ref|XP_002529373.1| Potassium channel AKT1, putative [Ricinus communis] gi|223531193|gb|EEF33040.1| Potassium channel AKT1, putative [Ricinus communis] Length = 901 Score = 142 bits (359), Expect = 2e-32 Identities = 65/83 (78%), Positives = 75/83 (90%) Frame = +1 Query: 1 PLSIIDNIVNGFFAIDIILTFFVAYLDKNTYLLVDNPKQIAWRYTSTWLAFDIVSTIPSE 180 PLSI DN+VNGFFA+DI+LTFFVAYLD +TYLLVD+PK+IAW+YTS+WLAFD++STIPSE Sbjct: 93 PLSITDNVVNGFFAVDILLTFFVAYLDHSTYLLVDDPKRIAWKYTSSWLAFDVISTIPSE 152 Query: 181 LARKISTGSLQSYGLFNMCRLWR 249 LARKIS QSYG FNM RLWR Sbjct: 153 LARKISPKPFQSYGFFNMLRLWR 175