BLASTX nr result
ID: Atractylodes21_contig00053532
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00053532 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEX99575.1| hypothetical chloroplast RF2 (chloroplast) [Chrys... 83 2e-14 ref|YP_007474773.1| hypothetical chloroplast RF2 (chloroplast) [... 83 2e-14 ref|YP_007353827.1| hypothetical chloroplast RF2 (chloroplast) [... 83 2e-14 ref|YP_007353810.1| hypothetical chloroplast RF2 (chloroplast) [... 83 2e-14 ref|YP_001837404.1| Ycf2 [Guizotia abyssinica] gi|183217801|ref|... 83 2e-14 >gb|AEX99575.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] Length = 2282 Score = 83.2 bits (204), Expect = 2e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 280 MTKALLRKRWLFPDEMQIGFMEQEKDFPFLSRKDMWP 170 MTKALLRKRWLFPDEMQIGFMEQEKDFPFLSRKDMWP Sbjct: 2246 MTKALLRKRWLFPDEMQIGFMEQEKDFPFLSRKDMWP 2282 >ref|YP_007474773.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] gi|452849111|ref|YP_007474789.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] gi|372863250|gb|AEX99322.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] gi|372863266|gb|AEX99338.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] gi|372863489|gb|AEX99558.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] Length = 2291 Score = 83.2 bits (204), Expect = 2e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 280 MTKALLRKRWLFPDEMQIGFMEQEKDFPFLSRKDMWP 170 MTKALLRKRWLFPDEMQIGFMEQEKDFPFLSRKDMWP Sbjct: 2255 MTKALLRKRWLFPDEMQIGFMEQEKDFPFLSRKDMWP 2291 >ref|YP_007353827.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum x morifolium] gi|375298897|gb|AFA45336.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum x morifolium] Length = 2282 Score = 83.2 bits (204), Expect = 2e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 280 MTKALLRKRWLFPDEMQIGFMEQEKDFPFLSRKDMWP 170 MTKALLRKRWLFPDEMQIGFMEQEKDFPFLSRKDMWP Sbjct: 2246 MTKALLRKRWLFPDEMQIGFMEQEKDFPFLSRKDMWP 2282 >ref|YP_007353810.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum x morifolium] gi|375298880|gb|AFA45319.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum x morifolium] Length = 2291 Score = 83.2 bits (204), Expect = 2e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 280 MTKALLRKRWLFPDEMQIGFMEQEKDFPFLSRKDMWP 170 MTKALLRKRWLFPDEMQIGFMEQEKDFPFLSRKDMWP Sbjct: 2255 MTKALLRKRWLFPDEMQIGFMEQEKDFPFLSRKDMWP 2291 >ref|YP_001837404.1| Ycf2 [Guizotia abyssinica] gi|183217801|ref|YP_001837421.1| Ycf2 [Guizotia abyssinica] gi|205412917|sp|B2LMN7.1|YCF2_GUIAB RecName: Full=Protein ycf2 gi|179366299|gb|ACB86570.1| hypothetical chloroplast RF21 [Guizotia abyssinica] gi|179366316|gb|ACB86587.1| hypothetical chloroplast RF21 [Guizotia abyssinica] Length = 2276 Score = 83.2 bits (204), Expect = 2e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 280 MTKALLRKRWLFPDEMQIGFMEQEKDFPFLSRKDMWP 170 MTKALLRKRWLFPDEMQIGFMEQEKDFPFLSRKDMWP Sbjct: 2240 MTKALLRKRWLFPDEMQIGFMEQEKDFPFLSRKDMWP 2276