BLASTX nr result
ID: Atractylodes21_contig00053436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00053436 (300 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004163108.1| PREDICTED: pentatricopeptide repeat-containi... 89 4e-16 ref|XP_004143696.1| PREDICTED: pentatricopeptide repeat-containi... 89 4e-16 ref|XP_002511099.1| pentatricopeptide repeat-containing protein,... 88 8e-16 ref|XP_002267947.2| PREDICTED: pentatricopeptide repeat-containi... 86 4e-15 emb|CBI28459.3| unnamed protein product [Vitis vinifera] 86 4e-15 >ref|XP_004163108.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Cucumis sativus] Length = 999 Score = 89.0 bits (219), Expect = 4e-16 Identities = 43/80 (53%), Positives = 53/80 (66%) Frame = +1 Query: 55 FSQLIYAYKSKGMLNEAVSVLLGSKSADCFPNSVCLNSLMSDLLKSNKMDLFWKVYERLA 234 F I ++ G LNEA SV + S S FP +C N+LM DLLK+N M LFWKVY + Sbjct: 175 FDIFIDKFRVLGFLNEASSVFIASISEGFFPTLICCNNLMRDLLKANMMGLFWKVYGSMV 234 Query: 235 ETKTNPDVYTYSNVIKAYCR 294 E K PDVYTY+NVIKA+C+ Sbjct: 235 EAKIVPDVYTYTNVIKAHCK 254 >ref|XP_004143696.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Cucumis sativus] Length = 1032 Score = 89.0 bits (219), Expect = 4e-16 Identities = 43/80 (53%), Positives = 53/80 (66%) Frame = +1 Query: 55 FSQLIYAYKSKGMLNEAVSVLLGSKSADCFPNSVCLNSLMSDLLKSNKMDLFWKVYERLA 234 F I ++ G LNEA SV + S S FP +C N+LM DLLK+N M LFWKVY + Sbjct: 175 FDIFIDKFRVLGFLNEASSVFIASISEGFFPTLICCNNLMRDLLKANMMGLFWKVYGSMV 234 Query: 235 ETKTNPDVYTYSNVIKAYCR 294 E K PDVYTY+NVIKA+C+ Sbjct: 235 EAKIVPDVYTYTNVIKAHCK 254 >ref|XP_002511099.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550214|gb|EEF51701.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1151 Score = 87.8 bits (216), Expect = 8e-16 Identities = 45/84 (53%), Positives = 56/84 (66%) Frame = +1 Query: 43 SSVGFSQLIYAYKSKGMLNEAVSVLLGSKSADCFPNSVCLNSLMSDLLKSNKMDLFWKVY 222 S V F LI Y+ KG LNEAVSV LG+K+ + C NSL DLLK N+++LFWKVY Sbjct: 162 SVVVFEILIDIYRKKGFLNEAVSVFLGAKTNEFIVGLACCNSLSKDLLKGNRVELFWKVY 221 Query: 223 ERLAETKTNPDVYTYSNVIKAYCR 294 + + PDVYTY+N+I AYCR Sbjct: 222 KGMLGAIV-PDVYTYTNLINAYCR 244 >ref|XP_002267947.2| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Vitis vinifera] Length = 1011 Score = 85.5 bits (210), Expect = 4e-15 Identities = 40/84 (47%), Positives = 59/84 (70%) Frame = +1 Query: 43 SSVGFSQLIYAYKSKGMLNEAVSVLLGSKSADCFPNSVCLNSLMSDLLKSNKMDLFWKVY 222 +SV F L+ +Y+ G L EAV+V LG K+ + P+ + NSL+ DLLK NK++LFWKV+ Sbjct: 144 NSVIFDMLMDSYRKMGFLVEAVNVFLGPKNFEFRPSLLSCNSLLGDLLKGNKVELFWKVF 203 Query: 223 ERLAETKTNPDVYTYSNVIKAYCR 294 + + K PDVYTY+N+I A+C+ Sbjct: 204 DGMCAHKVLPDVYTYTNMISAHCK 227 >emb|CBI28459.3| unnamed protein product [Vitis vinifera] Length = 973 Score = 85.5 bits (210), Expect = 4e-15 Identities = 40/84 (47%), Positives = 59/84 (70%) Frame = +1 Query: 43 SSVGFSQLIYAYKSKGMLNEAVSVLLGSKSADCFPNSVCLNSLMSDLLKSNKMDLFWKVY 222 +SV F L+ +Y+ G L EAV+V LG K+ + P+ + NSL+ DLLK NK++LFWKV+ Sbjct: 153 NSVIFDMLMDSYRKMGFLVEAVNVFLGPKNFEFRPSLLSCNSLLGDLLKGNKVELFWKVF 212 Query: 223 ERLAETKTNPDVYTYSNVIKAYCR 294 + + K PDVYTY+N+I A+C+ Sbjct: 213 DGMCAHKVLPDVYTYTNMISAHCK 236