BLASTX nr result
ID: Atractylodes21_contig00053324
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00053324 (475 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002868477.1| predicted protein [Arabidopsis lyrata subsp.... 57 2e-06 >ref|XP_002868477.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297314313|gb|EFH44736.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 57 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -2 Query: 258 PKDPLTIMGVNRTNHTFTTKLYPLQCNYYI 169 P DPLTI G+ TNHTFTTKLYPLQCNY I Sbjct: 28 PSDPLTIKGIKGTNHTFTTKLYPLQCNYCI 57