BLASTX nr result
ID: Atractylodes21_contig00053193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00053193 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138606.1| PREDICTED: TBC1 domain family member 2A-like... 60 1e-07 ref|NP_566323.1| RabGAP/TBC domain-containing protein [Arabidops... 60 1e-07 ref|XP_002884671.1| RabGAP/TBC domain-containing protein [Arabid... 60 1e-07 ref|XP_002532289.1| conserved hypothetical protein [Ricinus comm... 59 4e-07 >ref|XP_004138606.1| PREDICTED: TBC1 domain family member 2A-like [Cucumis sativus] gi|449490052|ref|XP_004158494.1| PREDICTED: TBC1 domain family member 2A-like [Cucumis sativus] Length = 395 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/42 (69%), Positives = 34/42 (80%), Gaps = 2/42 (4%) Frame = -1 Query: 122 MYAAQRKRDLSLEIQPEIPFLRPSIHARRA--VVKFQDLYGF 3 M+ Q KRD++LE+Q +IP LRPSIHARRA VKFQDLYGF Sbjct: 1 MFGTQSKRDIALELQAQIPILRPSIHARRANITVKFQDLYGF 42 >ref|NP_566323.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana] gi|145332002|ref|NP_001078123.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana] gi|98960973|gb|ABF58970.1| At3g07890 [Arabidopsis thaliana] gi|110737642|dbj|BAF00761.1| putative GTPase activator protein [Arabidopsis thaliana] gi|332641094|gb|AEE74615.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana] gi|332641095|gb|AEE74616.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana] Length = 400 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 2/42 (4%) Frame = -1 Query: 122 MYAAQRKRDLSLEIQPEIPFLRPSIHARRA--VVKFQDLYGF 3 M+ Q +RDL++E+Q +IP LRPSIHARRA VVKFQDLYGF Sbjct: 1 MFGIQSRRDLTMELQSQIPILRPSIHARRANIVVKFQDLYGF 42 >ref|XP_002884671.1| RabGAP/TBC domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297330511|gb|EFH60930.1| RabGAP/TBC domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 400 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 2/42 (4%) Frame = -1 Query: 122 MYAAQRKRDLSLEIQPEIPFLRPSIHARRA--VVKFQDLYGF 3 M+ Q +RDL++E+Q +IP LRPSIHARRA VVKFQDLYGF Sbjct: 1 MFGIQSRRDLTMELQSQIPILRPSIHARRANIVVKFQDLYGF 42 >ref|XP_002532289.1| conserved hypothetical protein [Ricinus communis] gi|223528023|gb|EEF30104.1| conserved hypothetical protein [Ricinus communis] Length = 398 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/42 (66%), Positives = 33/42 (78%), Gaps = 2/42 (4%) Frame = -1 Query: 122 MYAAQRKRDLSLEIQPEIPFLRPSIHARRA--VVKFQDLYGF 3 MY KR++SL+ QP+IP LRPSIH+RRA VKFQDLYGF Sbjct: 1 MYKTHTKREVSLDFQPQIPILRPSIHSRRANLTVKFQDLYGF 42