BLASTX nr result
ID: Atractylodes21_contig00052402
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00052402 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512879.1| conserved hypothetical protein [Ricinus comm... 57 1e-06 >ref|XP_002512879.1| conserved hypothetical protein [Ricinus communis] gi|223547890|gb|EEF49382.1| conserved hypothetical protein [Ricinus communis] Length = 753 Score = 57.4 bits (137), Expect = 1e-06 Identities = 35/93 (37%), Positives = 50/93 (53%), Gaps = 2/93 (2%) Frame = -1 Query: 280 NERESIGHCLDSSIGDCWGKTSLDKFRFPD--ALIKESTDVKVDVHGLRTGSKNKFDLST 107 N ++G + SS+GD KTSL FP ++ S +V ++HGL TGS K L T Sbjct: 45 NLSRTLGVTISSSLGDFQRKTSLQLSNFPQNSPRLEGSAEVTSNIHGLITGSMGKVGLIT 104 Query: 106 PKSVQSFRTSFSRIVGFESGKKDLSSDAFDGAS 8 P++ ++ + SRIVGFES D F+ S Sbjct: 105 PRNGRNIQNPASRIVGFESRGISSPKDGFEDFS 137