BLASTX nr result
ID: Atractylodes21_contig00052390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00052390 (445 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003630244.1| hypothetical protein MTR_8g093410 [Medicago ... 64 2e-08 ref|XP_003626920.1| GRF zinc finger containing protein [Medicago... 61 8e-08 ref|XP_003612076.1| GRF zinc finger containing protein [Medicago... 60 2e-07 ref|XP_003593148.1| GRF zinc finger containing protein [Medicago... 60 2e-07 ref|XP_003629442.1| GRF zinc finger containing protein [Medicago... 59 4e-07 >ref|XP_003630244.1| hypothetical protein MTR_8g093410 [Medicago truncatula] gi|355524266|gb|AET04720.1| hypothetical protein MTR_8g093410 [Medicago truncatula] Length = 109 Score = 63.5 bits (153), Expect = 2e-08 Identities = 31/72 (43%), Positives = 40/72 (55%) Frame = -2 Query: 396 SSFLVCLCGDKMKLSTSWTKSNPGRRFLGCPNYISGQKCQSFEFVDDELPNHYYKDLLFQ 217 SSFLVC CG + L T+WT NPGRRF GC Y +KC F + D E+P+ K + Sbjct: 13 SSFLVCYCGVESPLVTAWTDENPGRRFHGCGKYWQRRKCSFFRWFDPEVPDRQKKVIKGL 72 Query: 216 MHMRCTTLSKEK 181 + +KEK Sbjct: 73 LKKNDALKNKEK 84 >ref|XP_003626920.1| GRF zinc finger containing protein [Medicago truncatula] gi|355520942|gb|AET01396.1| GRF zinc finger containing protein [Medicago truncatula] Length = 116 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = -2 Query: 387 LVCLCGDKMKLSTSWTKSNPGRRFLGCPNYISGQKCQSFEFVDDELPNHYYK 232 LVC CG L TSWT NPGRRF GC Y G+KC F + D E+P+ K Sbjct: 20 LVCYCGVDSPLVTSWTDENPGRRFHGCGRYFVGRKCNFFRWYDPEVPDRQKK 71 >ref|XP_003612076.1| GRF zinc finger containing protein [Medicago truncatula] gi|355513411|gb|AES95034.1| GRF zinc finger containing protein [Medicago truncatula] Length = 116 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/56 (48%), Positives = 32/56 (57%) Frame = -2 Query: 399 ASSFLVCLCGDKMKLSTSWTKSNPGRRFLGCPNYISGQKCQSFEFVDDELPNHYYK 232 A S LVC CG + L T+WT NPGRRF GC Y +KC F + D E+P K Sbjct: 17 AKSRLVCYCGVESPLVTAWTDENPGRRFHGCGKYFQRRKCSFFRWFDPEVPERQKK 72 >ref|XP_003593148.1| GRF zinc finger containing protein [Medicago truncatula] gi|355482196|gb|AES63399.1| GRF zinc finger containing protein [Medicago truncatula] Length = 116 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/56 (48%), Positives = 32/56 (57%) Frame = -2 Query: 399 ASSFLVCLCGDKMKLSTSWTKSNPGRRFLGCPNYISGQKCQSFEFVDDELPNHYYK 232 A S LVC CG + L T+WT NPGRRF GC Y +KC F + D E+P K Sbjct: 17 AKSRLVCYCGVESPLVTAWTDENPGRRFHGCGKYFQRRKCSFFRWFDPEVPERRKK 72 >ref|XP_003629442.1| GRF zinc finger containing protein [Medicago truncatula] gi|355523464|gb|AET03918.1| GRF zinc finger containing protein [Medicago truncatula] Length = 75 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/52 (48%), Positives = 31/52 (59%) Frame = -2 Query: 387 LVCLCGDKMKLSTSWTKSNPGRRFLGCPNYISGQKCQSFEFVDDELPNHYYK 232 LVC CG L T+WT NPGRRF GC Y+ +KC F + D E+P+ K Sbjct: 21 LVCYCGVDSPLVTAWTDENPGRRFHGCGKYLQRRKCSFFRWFDPEVPDRQIK 72