BLASTX nr result
ID: Atractylodes21_contig00052301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00052301 (338 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003890572.1| hypothetical protein PGTG_20859 [Puccinia gr... 60 1e-07 ref|XP_002461219.1| hypothetical protein SORBIDRAFT_02g043110 [S... 60 1e-07 ref|XP_003623124.1| Ribosomal protein-like protein [Medicago tru... 60 2e-07 ref|XP_002464491.1| hypothetical protein SORBIDRAFT_01g019360 [S... 60 2e-07 gb|ABD65037.1| hypothetical protein 26.t00094 [Brassica oleracea] 59 3e-07 >ref|XP_003890572.1| hypothetical protein PGTG_20859 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gi|375169427|gb|EHS63877.1| hypothetical protein PGTG_20859 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 158 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/54 (50%), Positives = 37/54 (68%) Frame = +1 Query: 166 RNCEAGHMQLMNGYFSNVPVYHSEIFRRRFRIRQDLYLSIVNELETHYRYFFNK 327 R+ EAG+ QL YF+ PVY +FRRRFR+R L+LSIV++++ H YF K Sbjct: 32 RDFEAGYNQLFTDYFAENPVYPDHLFRRRFRMRHSLFLSIVDDVQEHDNYFLQK 85 >ref|XP_002461219.1| hypothetical protein SORBIDRAFT_02g043110 [Sorghum bicolor] gi|241924596|gb|EER97740.1| hypothetical protein SORBIDRAFT_02g043110 [Sorghum bicolor] Length = 153 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/63 (47%), Positives = 40/63 (63%) Frame = +1 Query: 130 SSNITNKR*YFNRNCEAGHMQLMNGYFSNVPVYHSEIFRRRFRIRQDLYLSIVNELETHY 309 S + N R Y NR+ EAGH +L+ YF+ P+Y FRRRFR+R+ ++L IVN LE Sbjct: 47 SGSSVNSRRYINRDHEAGHAKLVAEYFAENPLYTEYQFRRRFRMRKHIFLQIVNALENWS 106 Query: 310 RYF 318 YF Sbjct: 107 PYF 109 >ref|XP_003623124.1| Ribosomal protein-like protein [Medicago truncatula] gi|355498139|gb|AES79342.1| Ribosomal protein-like protein [Medicago truncatula] Length = 433 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/64 (46%), Positives = 38/64 (59%) Frame = +1 Query: 127 SSSNITNKR*YFNRNCEAGHMQLMNGYFSNVPVYHSEIFRRRFRIRQDLYLSIVNELETH 306 SSS +R RN E GH +L N YFS PV+ E FRRR+R+R+ ++L IV L H Sbjct: 40 SSSRPRRQRRNIERNREEGHKRLFNDYFSETPVFTDEQFRRRYRMRKHVFLRIVEALSQH 99 Query: 307 YRYF 318 YF Sbjct: 100 DEYF 103 >ref|XP_002464491.1| hypothetical protein SORBIDRAFT_01g019360 [Sorghum bicolor] gi|241918345|gb|EER91489.1| hypothetical protein SORBIDRAFT_01g019360 [Sorghum bicolor] Length = 274 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/63 (47%), Positives = 40/63 (63%) Frame = +1 Query: 130 SSNITNKR*YFNRNCEAGHMQLMNGYFSNVPVYHSEIFRRRFRIRQDLYLSIVNELETHY 309 S + N R Y NR+ EAGH +L+ YF+ P+Y FRRRFR+R+ ++L IVN LE Sbjct: 47 SGSSVNSRRYINRDHEAGHAKLVVEYFAENPLYTEYQFRRRFRMRKHIFLQIVNALENWS 106 Query: 310 RYF 318 YF Sbjct: 107 PYF 109 >gb|ABD65037.1| hypothetical protein 26.t00094 [Brassica oleracea] Length = 353 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/62 (41%), Positives = 38/62 (61%) Frame = +1 Query: 145 NKR*YFNRNCEAGHMQLMNGYFSNVPVYHSEIFRRRFRIRQDLYLSIVNELETHYRYFFN 324 NKR + RN E G ++L N YFS P Y +FRRRFR+ + L++ IV+ L + +F Sbjct: 39 NKRVHIERNREEGDLRLWNDYFSETPTYPDNLFRRRFRMNKPLFMHIVDRLSNEFEFFRQ 98 Query: 325 KQ 330 K+ Sbjct: 99 KK 100