BLASTX nr result
ID: Atractylodes21_contig00052197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00052197 (352 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511573.1| pentatricopeptide repeat-containing protein,... 63 2e-08 >ref|XP_002511573.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550688|gb|EEF52175.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 954 Score = 63.2 bits (152), Expect = 2e-08 Identities = 38/103 (36%), Positives = 51/103 (49%), Gaps = 1/103 (0%) Frame = +2 Query: 47 MKALLNHHLDLKI-SVYATKFLSSLVSLQTPLILPAKPHYPSNFSITFDPSQFLNESAKS 223 M L+N +L KI + +KF+SSL Q + DP F KS Sbjct: 1 MYFLINQNLQTKIIPISFSKFISSLPIFQNSSFTKPIKYEQEEPPSFLDPFHFFTNYIKS 60 Query: 224 RNFTFEETKIIHTHFLKTNTFHTNPEFSNFLLRSYCKASAFVY 352 + T EETK+IHTH +KT F++N +N LL YCK+ A Y Sbjct: 61 ADHTVEETKVIHTHLIKTALFNSNTVVANSLLDWYCKSGALFY 103