BLASTX nr result
ID: Atractylodes21_contig00052038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00052038 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002461954.1| hypothetical protein SORBIDRAFT_02g011140 [S... 59 4e-07 ref|XP_002468514.1| hypothetical protein SORBIDRAFT_01g047190 [S... 59 4e-07 ref|XP_002438303.1| hypothetical protein SORBIDRAFT_10g011520 [S... 59 4e-07 ref|XP_002467401.1| hypothetical protein SORBIDRAFT_01g027440 [S... 57 2e-06 ref|XP_002444198.1| hypothetical protein SORBIDRAFT_07g014876 [S... 56 3e-06 >ref|XP_002461954.1| hypothetical protein SORBIDRAFT_02g011140 [Sorghum bicolor] gi|241925331|gb|EER98475.1| hypothetical protein SORBIDRAFT_02g011140 [Sorghum bicolor] Length = 759 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/60 (41%), Positives = 36/60 (60%) Frame = +2 Query: 5 DPTRRANIWCTLCHKKVCGGITRLKQHLTHTGGQVTGCTKVTSEMQKKVLDSINGKKKER 184 DP + + C C+K++ GGI RLKQH+ H G T C K T E ++K S+ G K++R Sbjct: 36 DPNNKDKVKCKFCNKEMSGGIYRLKQHVAHDGKNTTKCPKCTDEAKEKCQKSLEGAKRKR 95 >ref|XP_002468514.1| hypothetical protein SORBIDRAFT_01g047190 [Sorghum bicolor] gi|241922368|gb|EER95512.1| hypothetical protein SORBIDRAFT_01g047190 [Sorghum bicolor] Length = 759 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/60 (41%), Positives = 36/60 (60%) Frame = +2 Query: 5 DPTRRANIWCTLCHKKVCGGITRLKQHLTHTGGQVTGCTKVTSEMQKKVLDSINGKKKER 184 DP + + C C+K++ GGI RLKQH+ H G T C K T E ++K S+ G K++R Sbjct: 36 DPNNKDKVKCKFCNKEMSGGIYRLKQHVAHDGKNTTKCPKCTDEAKEKCQKSLEGAKRKR 95 >ref|XP_002438303.1| hypothetical protein SORBIDRAFT_10g011520 [Sorghum bicolor] gi|241916526|gb|EER89670.1| hypothetical protein SORBIDRAFT_10g011520 [Sorghum bicolor] Length = 759 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/60 (41%), Positives = 36/60 (60%) Frame = +2 Query: 5 DPTRRANIWCTLCHKKVCGGITRLKQHLTHTGGQVTGCTKVTSEMQKKVLDSINGKKKER 184 DP + + C C+K++ GGI RLKQH+ H G T C K T E ++K S+ G K++R Sbjct: 36 DPNNKDKVKCKFCNKEMSGGIYRLKQHVAHDGKNTTKCPKCTDEAKEKCQKSLEGAKRKR 95 >ref|XP_002467401.1| hypothetical protein SORBIDRAFT_01g027440 [Sorghum bicolor] gi|241921255|gb|EER94399.1| hypothetical protein SORBIDRAFT_01g027440 [Sorghum bicolor] Length = 249 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/60 (43%), Positives = 35/60 (58%) Frame = +2 Query: 5 DPTRRANIWCTLCHKKVCGGITRLKQHLTHTGGQVTGCTKVTSEMQKKVLDSINGKKKER 184 DP + + C C+K + GGI RLKQH+ H G T C K T E + K SI+G K++R Sbjct: 39 DPKNKDKVKCKFCNKVMQGGIYRLKQHVAHDGKNATKCPKSTDEAKDKCQKSIDGAKRKR 98 >ref|XP_002444198.1| hypothetical protein SORBIDRAFT_07g014876 [Sorghum bicolor] gi|241940548|gb|EES13693.1| hypothetical protein SORBIDRAFT_07g014876 [Sorghum bicolor] Length = 183 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/60 (43%), Positives = 35/60 (58%) Frame = +2 Query: 5 DPTRRANIWCTLCHKKVCGGITRLKQHLTHTGGQVTGCTKVTSEMQKKVLDSINGKKKER 184 DP + + C C+K + GGI RLKQH+ H G VT C K E + K SI+G K++R Sbjct: 39 DPKNKDKVKCKFCNKVMQGGIYRLKQHVAHDGKNVTKCPKSIDEAKDKCKKSIDGAKRKR 98