BLASTX nr result
ID: Atractylodes21_contig00051808
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00051808 (262 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002444798.1| hypothetical protein SORBIDRAFT_07g028200 [S... 67 2e-09 ref|XP_003572922.1| PREDICTED: wall-associated receptor kinase 3... 66 3e-09 ref|XP_002444800.1| hypothetical protein SORBIDRAFT_07g028215 [S... 66 3e-09 gb|EEE69926.1| hypothetical protein OsJ_29789 [Oryza sativa Japo... 66 3e-09 ref|NP_001175896.1| Os09g0482640 [Oryza sativa Japonica Group] g... 66 3e-09 >ref|XP_002444798.1| hypothetical protein SORBIDRAFT_07g028200 [Sorghum bicolor] gi|241941148|gb|EES14293.1| hypothetical protein SORBIDRAFT_07g028200 [Sorghum bicolor] Length = 763 Score = 66.6 bits (161), Expect = 2e-09 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = -2 Query: 261 DECKVPEKYVCYGECTNTPGSYKCTCGKGYIGDAKIKDGC 142 DECK P +YVCYG C NTPGSY C C GY G+A I +GC Sbjct: 323 DECKYPNQYVCYGVCKNTPGSYICQCNTGYTGNASIPNGC 362 >ref|XP_003572922.1| PREDICTED: wall-associated receptor kinase 3-like [Brachypodium distachyon] Length = 761 Score = 66.2 bits (160), Expect = 3e-09 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = -2 Query: 261 DECKVPEKYVCYGECTNTPGSYKCTCGKGYIGDAKIKDGCEPR 133 DEC++ E++ CYG CTNTPGSY C C G GDA IK+GC P+ Sbjct: 311 DECQLKEEHPCYGVCTNTPGSYTCQCPPGTSGDATIKNGCRPK 353 >ref|XP_002444800.1| hypothetical protein SORBIDRAFT_07g028215 [Sorghum bicolor] gi|241941150|gb|EES14295.1| hypothetical protein SORBIDRAFT_07g028215 [Sorghum bicolor] Length = 472 Score = 66.2 bits (160), Expect = 3e-09 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = -2 Query: 261 DECKVPEKYVCYGECTNTPGSYKCTCGKGYIGDAKIKDGCE 139 DECK PE Y CYG CTNTPG++ C C GY G+A + +GCE Sbjct: 4 DECKSPESYSCYGNCTNTPGNFTCLCPTGYRGNASVLNGCE 44 >gb|EEE69926.1| hypothetical protein OsJ_29789 [Oryza sativa Japonica Group] Length = 713 Score = 66.2 bits (160), Expect = 3e-09 Identities = 27/45 (60%), Positives = 31/45 (68%) Frame = -2 Query: 261 DECKVPEKYVCYGECTNTPGSYKCTCGKGYIGDAKIKDGCEPRVL 127 DEC +PE+Y CYGECTN PGS+ C C G GDA + GCEP L Sbjct: 282 DECALPEEYPCYGECTNKPGSFSCMCPGGTHGDAMNEGGCEPTTL 326 >ref|NP_001175896.1| Os09g0482640 [Oryza sativa Japonica Group] gi|215704574|dbj|BAG94207.1| unnamed protein product [Oryza sativa Japonica Group] gi|255678991|dbj|BAH94624.1| Os09g0482640 [Oryza sativa Japonica Group] Length = 445 Score = 66.2 bits (160), Expect = 3e-09 Identities = 27/45 (60%), Positives = 31/45 (68%) Frame = -2 Query: 261 DECKVPEKYVCYGECTNTPGSYKCTCGKGYIGDAKIKDGCEPRVL 127 DEC +PE+Y CYGECTN PGS+ C C G GDA + GCEP L Sbjct: 14 DECALPEEYPCYGECTNKPGSFSCMCPGGTHGDAMNEGGCEPTTL 58