BLASTX nr result
ID: Atractylodes21_contig00051753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00051753 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533910.1| conserved hypothetical protein [Ricinus comm... 87 1e-15 ref|XP_003553780.1| PREDICTED: uncharacterized protein LOC100795... 82 5e-14 gb|AFW86836.1| putative DUF231 domain containing family protein ... 80 2e-13 gb|ACN26149.1| unknown [Zea mays] 80 2e-13 ref|NP_001140539.1| uncharacterized protein LOC100272604 [Zea ma... 80 2e-13 >ref|XP_002533910.1| conserved hypothetical protein [Ricinus communis] gi|223526131|gb|EEF28475.1| conserved hypothetical protein [Ricinus communis] Length = 457 Score = 87.0 bits (214), Expect = 1e-15 Identities = 42/75 (56%), Positives = 49/75 (65%), Gaps = 2/75 (2%) Frame = +3 Query: 6 TGGYCNRTVPFKDGEXXXXXXXXXXXXXELEEFANAKV--ALNGSVLRLFDTTGLSLLRP 179 +GG CNRTVPFK+GE ELEEF A + A G++ +L DTT LSLLRP Sbjct: 349 SGGTCNRTVPFKEGEVDMRDVDTAMRNIELEEFERAAILGAKTGAIFKLLDTTRLSLLRP 408 Query: 180 DGHPGPYRVFHPFDR 224 DGHPGPYR FHPF + Sbjct: 409 DGHPGPYRQFHPFSK 423 >ref|XP_003553780.1| PREDICTED: uncharacterized protein LOC100795653 [Glycine max] Length = 441 Score = 82.0 bits (201), Expect = 5e-14 Identities = 40/70 (57%), Positives = 47/70 (67%) Frame = +3 Query: 6 TGGYCNRTVPFKDGEXXXXXXXXXXXXXELEEFANAKVALNGSVLRLFDTTGLSLLRPDG 185 +GGYCNRTVPFK+ + ELEEF K + + + L+L DTTGLSLLRPDG Sbjct: 340 SGGYCNRTVPFKEDQVEVSYVDSIIRGIELEEFHKTKNS-SANNLKLLDTTGLSLLRPDG 398 Query: 186 HPGPYRVFHP 215 HPGPYR FHP Sbjct: 399 HPGPYRQFHP 408 >gb|AFW86836.1| putative DUF231 domain containing family protein [Zea mays] Length = 428 Score = 80.1 bits (196), Expect = 2e-13 Identities = 39/73 (53%), Positives = 46/73 (63%) Frame = +3 Query: 6 TGGYCNRTVPFKDGEXXXXXXXXXXXXXELEEFANAKVALNGSVLRLFDTTGLSLLRPDG 185 +GG CNRT PFK GE E EEF NA V + G L+L DT LSLLRPDG Sbjct: 324 SGGTCNRTAPFKPGEAGDREWDNSMWRIEREEFHNA-VPIGGDRLKLLDTFELSLLRPDG 382 Query: 186 HPGPYRVFHPFDR 224 HPGPYR +HP+++ Sbjct: 383 HPGPYRAYHPYEK 395 >gb|ACN26149.1| unknown [Zea mays] Length = 314 Score = 80.1 bits (196), Expect = 2e-13 Identities = 39/73 (53%), Positives = 46/73 (63%) Frame = +3 Query: 6 TGGYCNRTVPFKDGEXXXXXXXXXXXXXELEEFANAKVALNGSVLRLFDTTGLSLLRPDG 185 +GG CNRT PFK GE E EEF NA V + G L+L DT LSLLRPDG Sbjct: 210 SGGTCNRTAPFKPGEAGDREWDNSMWRIEREEFHNA-VPIGGDRLKLLDTFELSLLRPDG 268 Query: 186 HPGPYRVFHPFDR 224 HPGPYR +HP+++ Sbjct: 269 HPGPYRAYHPYEK 281 >ref|NP_001140539.1| uncharacterized protein LOC100272604 [Zea mays] gi|194699918|gb|ACF84043.1| unknown [Zea mays] gi|238009384|gb|ACR35727.1| unknown [Zea mays] gi|413954188|gb|AFW86837.1| putative DUF231 domain containing family protein isoform 1 [Zea mays] gi|413954189|gb|AFW86838.1| putative DUF231 domain containing family protein isoform 2 [Zea mays] Length = 456 Score = 80.1 bits (196), Expect = 2e-13 Identities = 39/73 (53%), Positives = 46/73 (63%) Frame = +3 Query: 6 TGGYCNRTVPFKDGEXXXXXXXXXXXXXELEEFANAKVALNGSVLRLFDTTGLSLLRPDG 185 +GG CNRT PFK GE E EEF NA V + G L+L DT LSLLRPDG Sbjct: 352 SGGTCNRTAPFKPGEAGDREWDNSMWRIEREEFHNA-VPIGGDRLKLLDTFELSLLRPDG 410 Query: 186 HPGPYRVFHPFDR 224 HPGPYR +HP+++ Sbjct: 411 HPGPYRAYHPYEK 423