BLASTX nr result
ID: Atractylodes21_contig00051620
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00051620 (326 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528200.1| regulator of telomere elongation helicase 1 ... 139 2e-31 ref|XP_002279773.2| PREDICTED: regulator of telomere elongation ... 134 6e-30 ref|XP_003542103.1| PREDICTED: regulator of telomere elongation ... 121 7e-26 ref|XP_004141849.1| PREDICTED: regulator of telomere elongation ... 117 1e-24 ref|XP_003597782.1| Regulator of telomere elongation helicase [M... 112 4e-23 >ref|XP_002528200.1| regulator of telomere elongation helicase 1 rtel1, putative [Ricinus communis] gi|223532412|gb|EEF34207.1| regulator of telomere elongation helicase 1 rtel1, putative [Ricinus communis] Length = 1049 Score = 139 bits (351), Expect = 2e-31 Identities = 68/102 (66%), Positives = 84/102 (82%) Frame = -3 Query: 315 TEFVSSETRSAISTCSPCDDEEEKKGSTFLIQVREKLSDGEYKEFVGFMKALKAKAMKIG 136 TE ++ +++ +T PC DEE K+GS FLIQV+EKL+ EYKEFVGFMKALK+KAM+IG Sbjct: 910 TELLTQKSKGVQTTLVPCSDEE-KRGSAFLIQVKEKLTAAEYKEFVGFMKALKSKAMQIG 968 Query: 135 HVLQCIMRLFSAPDRLPLLQRFKDYIPAKYHSLYEQYLENTN 10 VL+ I++LFS PDR PLL+RFKDYIPAKYHSLYE YLE T+ Sbjct: 969 SVLESIVKLFSGPDRFPLLKRFKDYIPAKYHSLYEHYLEATD 1010 >ref|XP_002279773.2| PREDICTED: regulator of telomere elongation helicase 1-like [Vitis vinifera] Length = 1084 Score = 134 bits (338), Expect = 6e-30 Identities = 68/103 (66%), Positives = 82/103 (79%) Frame = -3 Query: 324 QKSTEFVSSETRSAISTCSPCDDEEEKKGSTFLIQVREKLSDGEYKEFVGFMKALKAKAM 145 +K EF+S + + S+ PC +E +GS FLIQV+EKLS EYKEFVGFMKALK+KAM Sbjct: 945 KKDAEFLSQKGKGVQSSPLPCS-VKETRGSAFLIQVQEKLSTAEYKEFVGFMKALKSKAM 1003 Query: 144 KIGHVLQCIMRLFSAPDRLPLLQRFKDYIPAKYHSLYEQYLEN 16 KIG VL+ I RLFS P+RLPLL+RFKDYIPAKY SLY+QYL+N Sbjct: 1004 KIGQVLESIARLFSGPERLPLLKRFKDYIPAKYQSLYQQYLKN 1046 >ref|XP_003542103.1| PREDICTED: regulator of telomere elongation helicase 1-like [Glycine max] Length = 1001 Score = 121 bits (303), Expect = 7e-26 Identities = 58/78 (74%), Positives = 64/78 (82%) Frame = -3 Query: 252 EEKKGSTFLIQVREKLSDGEYKEFVGFMKALKAKAMKIGHVLQCIMRLFSAPDRLPLLQR 73 +E KGS FL QVR+KLS EY FVG+MKALK K MKI VLQCI RLF+ PDRLPLL+R Sbjct: 922 DETKGSAFLAQVRDKLSAAEYINFVGYMKALKTKTMKISEVLQCISRLFTGPDRLPLLKR 981 Query: 72 FKDYIPAKYHSLYEQYLE 19 FKDYIPAKYHSLYE Y+E Sbjct: 982 FKDYIPAKYHSLYEHYVE 999 >ref|XP_004141849.1| PREDICTED: regulator of telomere elongation helicase 1-like [Cucumis sativus] Length = 1054 Score = 117 bits (292), Expect = 1e-24 Identities = 60/78 (76%), Positives = 63/78 (80%) Frame = -3 Query: 255 EEEKKGSTFLIQVREKLSDGEYKEFVGFMKALKAKAMKIGHVLQCIMRLFSAPDRLPLLQ 76 +EE KGS FL QVREKLSD EYKEFVGFMKALK KAM I HVLQ I+R+FS PDRL L Sbjct: 973 DEEAKGSDFLSQVREKLSDREYKEFVGFMKALKTKAMGITHVLQSIVRIFSGPDRLRLRT 1032 Query: 75 RFKDYIPAKYHSLYEQYL 22 FKDYIPAKYH LYEQ L Sbjct: 1033 GFKDYIPAKYHFLYEQLL 1050 >ref|XP_003597782.1| Regulator of telomere elongation helicase [Medicago truncatula] gi|355486830|gb|AES68033.1| Regulator of telomere elongation helicase [Medicago truncatula] Length = 1089 Score = 112 bits (279), Expect = 4e-23 Identities = 54/75 (72%), Positives = 62/75 (82%) Frame = -3 Query: 243 KGSTFLIQVREKLSDGEYKEFVGFMKALKAKAMKIGHVLQCIMRLFSAPDRLPLLQRFKD 64 +GS FL QVR+KLS EY +FVG+MKALK K +KI VL I RLFS P+RLPLL+RFKD Sbjct: 994 QGSAFLAQVRDKLSAAEYIDFVGYMKALKTKTLKISEVLLSISRLFSGPERLPLLKRFKD 1053 Query: 63 YIPAKYHSLYEQYLE 19 YIPAKYHSLYEQY+E Sbjct: 1054 YIPAKYHSLYEQYVE 1068