BLASTX nr result
ID: Atractylodes21_contig00051444
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00051444 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003534730.1| PREDICTED: uncharacterized protein LOC100811... 100 2e-19 ref|XP_003610508.1| hypothetical protein MTR_4g132970 [Medicago ... 97 2e-18 ref|XP_003610505.1| hypothetical protein MTR_4g132940 [Medicago ... 97 2e-18 ref|XP_003547277.1| PREDICTED: uncharacterized protein LOC100807... 96 3e-18 ref|XP_003528702.1| PREDICTED: uncharacterized protein LOC100800... 95 5e-18 >ref|XP_003534730.1| PREDICTED: uncharacterized protein LOC100811764 [Glycine max] Length = 281 Score = 100 bits (248), Expect = 2e-19 Identities = 46/77 (59%), Positives = 60/77 (77%) Frame = +2 Query: 2 ARPSENYASLLDVFPQISVCKVEELKKIVRIMCDAMKKSMNQQHLLVPPWRQYDYVQAKW 181 ARP++ Y+SLLDVFP I V KVEE+K++VR+MC A+K SM + L +PPWR+ Y+QAKW Sbjct: 152 ARPTDQYSSLLDVFPLIFVGKVEEMKQVVRLMCTAIKGSMKRMKLHIPPWRRNVYMQAKW 211 Query: 182 FGSYKRITNQFPTKSVA 232 FG+YKR TN TK V+ Sbjct: 212 FGAYKRTTNAVATKRVS 228 >ref|XP_003610508.1| hypothetical protein MTR_4g132970 [Medicago truncatula] gi|355511563|gb|AES92705.1| hypothetical protein MTR_4g132970 [Medicago truncatula] Length = 305 Score = 96.7 bits (239), Expect = 2e-18 Identities = 44/73 (60%), Positives = 54/73 (73%) Frame = +2 Query: 2 ARPSENYASLLDVFPQISVCKVEELKKIVRIMCDAMKKSMNQQHLLVPPWRQYDYVQAKW 181 ARP+ Y SLLDVFP + V KVEELK++VRIMC A+K SM + VPPWR+ Y+QAKW Sbjct: 194 ARPTNQYTSLLDVFPLVFVGKVEELKRVVRIMCSAIKDSMKTMDMHVPPWRRNSYMQAKW 253 Query: 182 FGSYKRITNQFPT 220 F +YKR TN+ T Sbjct: 254 FNTYKRTTNEVAT 266 >ref|XP_003610505.1| hypothetical protein MTR_4g132940 [Medicago truncatula] gi|355511560|gb|AES92702.1| hypothetical protein MTR_4g132940 [Medicago truncatula] Length = 287 Score = 96.7 bits (239), Expect = 2e-18 Identities = 44/73 (60%), Positives = 54/73 (73%) Frame = +2 Query: 2 ARPSENYASLLDVFPQISVCKVEELKKIVRIMCDAMKKSMNQQHLLVPPWRQYDYVQAKW 181 ARP+ Y SLLDVFP + V KVEELK++VRIMC A+K SM + VPPWR+ Y+QAKW Sbjct: 176 ARPTNQYTSLLDVFPLVFVGKVEELKRVVRIMCSAIKDSMKTMDMHVPPWRRNSYMQAKW 235 Query: 182 FGSYKRITNQFPT 220 F +YKR TN+ T Sbjct: 236 FNTYKRTTNEVAT 248 >ref|XP_003547277.1| PREDICTED: uncharacterized protein LOC100807096 [Glycine max] Length = 312 Score = 95.9 bits (237), Expect = 3e-18 Identities = 43/74 (58%), Positives = 57/74 (77%) Frame = +2 Query: 2 ARPSENYASLLDVFPQISVCKVEELKKIVRIMCDAMKKSMNQQHLLVPPWRQYDYVQAKW 181 ARP++ Y+SLLDVFP I V KVEE+K++ R+MC A+K SM + +L +PPWR+ Y+QAKW Sbjct: 183 ARPTDQYSSLLDVFPLIFVGKVEEMKQVARLMCTALKGSMKRMNLHIPPWRRNMYMQAKW 242 Query: 182 FGSYKRITNQFPTK 223 F +YKR TN TK Sbjct: 243 FSAYKRTTNAVATK 256 >ref|XP_003528702.1| PREDICTED: uncharacterized protein LOC100800496 [Glycine max] Length = 297 Score = 95.1 bits (235), Expect = 5e-18 Identities = 42/79 (53%), Positives = 59/79 (74%) Frame = +2 Query: 2 ARPSENYASLLDVFPQISVCKVEELKKIVRIMCDAMKKSMNQQHLLVPPWRQYDYVQAKW 181 AR ++ YA+LLDVFP I V K+EELK++VR+MC A+K SM ++ +PPWR+ Y+QAKW Sbjct: 172 ARSTDQYAALLDVFPLIFVGKMEELKQVVRLMCTAIKGSMKSMNMYIPPWRRIGYMQAKW 231 Query: 182 FGSYKRITNQFPTKSVADS 238 F SYKRIT++ T + + Sbjct: 232 FSSYKRITDEVATNRASSA 250