BLASTX nr result
ID: Atractylodes21_contig00051409
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00051409 (359 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN83506.1| hypothetical protein VITISV_027576 [Vitis vinifera] 58 7e-07 emb|CAN62533.1| hypothetical protein VITISV_030700 [Vitis vinifera] 58 7e-07 >emb|CAN83506.1| hypothetical protein VITISV_027576 [Vitis vinifera] Length = 1172 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = +2 Query: 191 HIQLPSP-DTEPATFTIANRYPQWRSAMADEYSALMRNGTWTLVP 322 HIQL P D EP T T A + P+WR AM++EY AL+RNGTW LVP Sbjct: 645 HIQLSKPLDLEPTTPTQALKDPKWRKAMSEEYDALVRNGTWELVP 689 >emb|CAN62533.1| hypothetical protein VITISV_030700 [Vitis vinifera] Length = 731 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = +2 Query: 191 HIQLPSP-DTEPATFTIANRYPQWRSAMADEYSALMRNGTWTLVP 322 HIQL P D EP T T A + P+WR AM++EY AL+RNGTW LVP Sbjct: 682 HIQLSKPLDLEPTTPTQALKDPKWRKAMSEEYDALVRNGTWELVP 726