BLASTX nr result
ID: Atractylodes21_contig00051362
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00051362 (300 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002489074.1| hypothetical protein SORBIDRAFT_0139s002040 ... 79 4e-13 ref|XP_002456118.1| hypothetical protein SORBIDRAFT_03g030787 [S... 79 4e-13 ref|XP_002460196.1| hypothetical protein SORBIDRAFT_02g024427 [S... 79 4e-13 ref|XP_002440449.1| hypothetical protein SORBIDRAFT_09g001135 [S... 78 7e-13 ref|XP_002444329.1| hypothetical protein SORBIDRAFT_07g020255 [S... 78 7e-13 >ref|XP_002489074.1| hypothetical protein SORBIDRAFT_0139s002040 [Sorghum bicolor] gi|241947124|gb|EES20269.1| hypothetical protein SORBIDRAFT_0139s002040 [Sorghum bicolor] Length = 1822 Score = 79.0 bits (193), Expect = 4e-13 Identities = 33/52 (63%), Positives = 42/52 (80%) Frame = +3 Query: 3 NTSATQPHKLHPRAIRCIFLGYPPDFRGYRCFDPTTGKVSISRHVTFDETVF 158 NT+AT PHKL PR+ C+FLGY PD +GYRC+D T+ +V ISRHV FDE++F Sbjct: 1054 NTTATAPHKLAPRSTLCVFLGYSPDHKGYRCYDLTSRRVLISRHVVFDESIF 1105 >ref|XP_002456118.1| hypothetical protein SORBIDRAFT_03g030787 [Sorghum bicolor] gi|241928093|gb|EES01238.1| hypothetical protein SORBIDRAFT_03g030787 [Sorghum bicolor] Length = 1567 Score = 79.0 bits (193), Expect = 4e-13 Identities = 33/52 (63%), Positives = 42/52 (80%) Frame = +3 Query: 3 NTSATQPHKLHPRAIRCIFLGYPPDFRGYRCFDPTTGKVSISRHVTFDETVF 158 NT+AT PHKL PR+ C+FLGY PD +GYRC+D T+ +V ISRHV FDE++F Sbjct: 804 NTTATAPHKLAPRSTLCVFLGYSPDHKGYRCYDLTSRRVLISRHVVFDESIF 855 >ref|XP_002460196.1| hypothetical protein SORBIDRAFT_02g024427 [Sorghum bicolor] gi|241923573|gb|EER96717.1| hypothetical protein SORBIDRAFT_02g024427 [Sorghum bicolor] Length = 1575 Score = 79.0 bits (193), Expect = 4e-13 Identities = 33/52 (63%), Positives = 42/52 (80%) Frame = +3 Query: 3 NTSATQPHKLHPRAIRCIFLGYPPDFRGYRCFDPTTGKVSISRHVTFDETVF 158 NT+AT PHKL PR+ C+FLGY PD +GYRC+D T+ +V ISRHV FDE++F Sbjct: 807 NTTATAPHKLAPRSTLCVFLGYSPDHKGYRCYDLTSRRVLISRHVVFDESIF 858 >ref|XP_002440449.1| hypothetical protein SORBIDRAFT_09g001135 [Sorghum bicolor] gi|241945734|gb|EES18879.1| hypothetical protein SORBIDRAFT_09g001135 [Sorghum bicolor] Length = 488 Score = 78.2 bits (191), Expect = 7e-13 Identities = 34/52 (65%), Positives = 41/52 (78%) Frame = +3 Query: 3 NTSATQPHKLHPRAIRCIFLGYPPDFRGYRCFDPTTGKVSISRHVTFDETVF 158 NT+AT PHKL PR+ C+FLGY PD +GYRC+D T+ +V ISRHV FDE VF Sbjct: 119 NTTATAPHKLAPRSTLCVFLGYSPDHKGYRCYDLTSRRVLISRHVVFDEFVF 170 >ref|XP_002444329.1| hypothetical protein SORBIDRAFT_07g020255 [Sorghum bicolor] gi|241940679|gb|EES13824.1| hypothetical protein SORBIDRAFT_07g020255 [Sorghum bicolor] Length = 987 Score = 78.2 bits (191), Expect = 7e-13 Identities = 34/52 (65%), Positives = 41/52 (78%) Frame = +3 Query: 3 NTSATQPHKLHPRAIRCIFLGYPPDFRGYRCFDPTTGKVSISRHVTFDETVF 158 NT+AT PHKL PR+ C+FLGY PD +GYRC+D T+ +V ISRHV FDE VF Sbjct: 233 NTTATAPHKLAPRSTLCVFLGYSPDHKGYRCYDLTSRRVLISRHVVFDEFVF 284