BLASTX nr result
ID: Atractylodes21_contig00051278
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00051278 (479 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531632.1| DNA binding protein, putative [Ricinus commu... 57 2e-06 >ref|XP_002531632.1| DNA binding protein, putative [Ricinus communis] gi|223528750|gb|EEF30760.1| DNA binding protein, putative [Ricinus communis] Length = 358 Score = 56.6 bits (135), Expect = 2e-06 Identities = 34/88 (38%), Positives = 49/88 (55%), Gaps = 6/88 (6%) Frame = +1 Query: 94 PEETETIVSLNPSKSTTKRYKGVWRRN-GRWIARIRNPLTNSRVFLGRFHSSEAALHAYF 270 P T T + +KS K+ GV +R G+W A IRNPLT R +LG +++ E A AY Sbjct: 113 PATTPTTTAAATTKSALKKPVGVRQRKWGKWAAEIRNPLTKVRTWLGTYNTLEEAAQAYE 172 Query: 271 SNKRAFESQCRAA-----NVSNSVMIDN 339 + KR +++ AA N+S+SV N Sbjct: 173 AKKREYDAMTMAASEKSQNISSSVEESN 200