BLASTX nr result
ID: Atractylodes21_contig00051230
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00051230 (320 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN08132.1| Putative non-LTR retroelement reverse transcripta... 63 3e-08 ref|XP_003635790.1| Receptor-like kinase [Medicago truncatula] g... 59 4e-07 >gb|ABN08132.1| Putative non-LTR retroelement reverse transcriptase, related [Medicago truncatula] Length = 532 Score = 62.8 bits (151), Expect = 3e-08 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 3/109 (2%) Frame = -1 Query: 320 WNWRRDIRDGRERDQLESLINSLPSHFSNDDRDGWSWKLEKKSYFSVAQVREYI--DNKY 147 W WRR + E E + + D WSW L+ + +SV + +I +Y Sbjct: 294 WVWRRGLLAWEEDSVRECTLLLHNVVLQVNVPDKWSWLLDPINGYSVRESYRHITTSGEY 353 Query: 146 LSFTVNNNYWNNWVPKKINLFVWRLVRNGIPTNVNLFGRGVDV-NFVSC 3 + +V ++ W+ ++P+K++LFVWRL+RN +PT NL R + + N V C Sbjct: 354 VDQSVVDDVWHRYIPQKVSLFVWRLLRNRLPTKDNLMRRRIILANVVDC 402 >ref|XP_003635790.1| Receptor-like kinase [Medicago truncatula] gi|355501725|gb|AES82928.1| Receptor-like kinase [Medicago truncatula] Length = 2313 Score = 58.9 bits (141), Expect = 4e-07 Identities = 34/109 (31%), Positives = 52/109 (47%), Gaps = 3/109 (2%) Frame = -1 Query: 320 WNWRRDIRDGRERDQLESLINSLPSHFSNDDRDGWSWKLEKKSYFSVAQVREYI--DNKY 147 W WRR + E E + + D W W L+ +SV + +I + Sbjct: 1525 WVWRRRLLAWEEESVRECSLLLHNFVLQVNIFDKWRWTLDTVHGYSVREAYRFIVSHGDH 1584 Query: 146 LSFTVNNNYWNNWVPKKINLFVWRLVRNGIPTNVNLFGRGV-DVNFVSC 3 L + + W+N++P K++LFVWRL+RN +PT NL R + N V C Sbjct: 1585 LDRSSVDKVWHNYIPSKVSLFVWRLLRNRLPTRGNLLRRNILHANNVMC 1633