BLASTX nr result
ID: Atractylodes21_contig00051221
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00051221 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272822.2| PREDICTED: shugoshin-1-like [Vitis vinifera]... 55 8e-06 >ref|XP_002272822.2| PREDICTED: shugoshin-1-like [Vitis vinifera] gi|296085974|emb|CBI31415.3| unnamed protein product [Vitis vinifera] Length = 317 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = -3 Query: 226 GDSLEDHKPQEQRRTSVSRPLREAAKKVQSYKEINVNVKMRRNE 95 GD + E RR+S+ RPLR AA+KVQSYKEI +NVKMRR+E Sbjct: 274 GDGALEVATPEFRRSSIGRPLRRAAEKVQSYKEIPINVKMRRSE 317