BLASTX nr result
ID: Atractylodes21_contig00050919
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00050919 (447 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI23068.3| unnamed protein product [Vitis vinifera] 70 2e-10 ref|XP_002273024.1| PREDICTED: CDPK-related protein kinase isofo... 70 2e-10 emb|CAN64098.1| hypothetical protein VITISV_014897 [Vitis vinifera] 70 2e-10 ref|XP_004166903.1| PREDICTED: LOW QUALITY PROTEIN: CDPK-related... 69 3e-10 ref|XP_004140506.1| PREDICTED: CDPK-related protein kinase-like ... 69 3e-10 >emb|CBI23068.3| unnamed protein product [Vitis vinifera] Length = 494 Score = 69.7 bits (169), Expect = 2e-10 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 2/50 (4%) Frame = +2 Query: 248 ESGIFLAVLRADPNFDDIPWPFVSPKVKGLIKRLLKNYY--RMSAAQSLT 391 ESGIF +VLRADPNFDD+PWP VSP+ K +KRLL Y RM+AAQ+LT Sbjct: 250 ESGIFRSVLRADPNFDDLPWPAVSPEAKDFVKRLLNKDYRKRMTAAQALT 299 >ref|XP_002273024.1| PREDICTED: CDPK-related protein kinase isoform 1 [Vitis vinifera] Length = 592 Score = 69.7 bits (169), Expect = 2e-10 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 2/50 (4%) Frame = +2 Query: 248 ESGIFLAVLRADPNFDDIPWPFVSPKVKGLIKRLLKNYY--RMSAAQSLT 391 ESGIF +VLRADPNFDD+PWP VSP+ K +KRLL Y RM+AAQ+LT Sbjct: 348 ESGIFRSVLRADPNFDDLPWPAVSPEAKDFVKRLLNKDYRKRMTAAQALT 397 >emb|CAN64098.1| hypothetical protein VITISV_014897 [Vitis vinifera] Length = 604 Score = 69.7 bits (169), Expect = 2e-10 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 2/50 (4%) Frame = +2 Query: 248 ESGIFLAVLRADPNFDDIPWPFVSPKVKGLIKRLLKNYY--RMSAAQSLT 391 ESGIF +VLRADPNFDD+PWP VSP+ K +KRLL Y RM+AAQ+LT Sbjct: 360 ESGIFRSVLRADPNFDDLPWPAVSPEAKDFVKRLLNKDYRKRMTAAQALT 409 >ref|XP_004166903.1| PREDICTED: LOW QUALITY PROTEIN: CDPK-related protein kinase-like [Cucumis sativus] Length = 609 Score = 69.3 bits (168), Expect = 3e-10 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 2/50 (4%) Frame = +2 Query: 248 ESGIFLAVLRADPNFDDIPWPFVSPKVKGLIKRLLKNYY--RMSAAQSLT 391 ESGIF AVLRADPNFDD+PWP VSP+ K +KRLL Y RM+A Q+LT Sbjct: 367 ESGIFRAVLRADPNFDDLPWPSVSPEAKDFVKRLLNKDYRKRMTAVQALT 416 >ref|XP_004140506.1| PREDICTED: CDPK-related protein kinase-like [Cucumis sativus] Length = 609 Score = 69.3 bits (168), Expect = 3e-10 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 2/50 (4%) Frame = +2 Query: 248 ESGIFLAVLRADPNFDDIPWPFVSPKVKGLIKRLLKNYY--RMSAAQSLT 391 ESGIF AVLRADPNFDD+PWP VSP+ K +KRLL Y RM+A Q+LT Sbjct: 367 ESGIFRAVLRADPNFDDLPWPSVSPEAKDFVKRLLNKDYRKRMTAVQALT 416