BLASTX nr result
ID: Atractylodes21_contig00050816
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00050816 (371 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515332.1| conserved hypothetical protein [Ricinus comm... 68 7e-10 >ref|XP_002515332.1| conserved hypothetical protein [Ricinus communis] gi|223545812|gb|EEF47316.1| conserved hypothetical protein [Ricinus communis] Length = 171 Score = 68.2 bits (165), Expect = 7e-10 Identities = 36/69 (52%), Positives = 41/69 (59%) Frame = -2 Query: 208 QRFEEMMQLMRELRGPPRVESPGSSNHEGTNPNRSLGYVPKLDFPKFDGPNPRIWIKKCC 29 Q +E M + E+R P E +N R LGY+PKL FPKFDG N R WIKKCC Sbjct: 3 QTLKENMLIALEVRSP--------RFDERSNQPR-LGYIPKLKFPKFDGSNLRQWIKKCC 53 Query: 28 KYFALCKIP 2 KYF CKIP Sbjct: 54 KYFVFCKIP 62