BLASTX nr result
ID: Atractylodes21_contig00050778
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00050778 (350 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66235.1| hypothetical protein [Beta vulgaris subsp. vulga... 56 4e-06 >emb|CCA66235.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1380 Score = 55.8 bits (133), Expect = 4e-06 Identities = 32/98 (32%), Positives = 43/98 (43%) Frame = +3 Query: 42 ALSWSWECVREPRGRSLSELEILKNLVHVESFD*GNRDRWAWSLDNKGSFSVRRLREIVD 221 A +WS+ R R R L E E L L+ + D N+D WS GSFS + Sbjct: 977 AWAWSFSWARHHRARDLDEKEKLLELLDMVHLDPSNQDSLVWSYHKSGSFSTSSFTAEMA 1036 Query: 222 GKILDPTSSLEETSWCSLVPRKVNVFLWRLRRGGIPVR 335 L P + + W LVP +V +F+W G I R Sbjct: 1037 KANLPPHTDAIKGVWVGLVPHRVEIFVWMALLGRINTR 1074