BLASTX nr result
ID: Atractylodes21_contig00050732
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00050732 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001958005.1| hypothetical protein Aasi_0909 [Candidatus A... 55 6e-06 >ref|YP_001958005.1| hypothetical protein Aasi_0909 [Candidatus Amoebophilus asiaticus 5a2] gi|189497729|gb|ACE06276.1| hypothetical protein Aasi_0909 [Candidatus Amoebophilus asiaticus 5a2] Length = 865 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/71 (42%), Positives = 41/71 (57%) Frame = -1 Query: 266 LIMKKCRIKPSNEEKGGTALHAAARKGSKECIQYLLSLNSRLLYERDDKQLIPLDVAVLS 87 L+ +K + + + G T LH A KG KE IQ LL++ LY +D+ PL +AVL Sbjct: 631 LLARKAEVN-AEDMHGNTPLHKAVEKGDKEAIQALLAVKEIKLYAKDNDGNTPLHIAVLK 689 Query: 86 GHESAAKALLD 54 G+E A ALLD Sbjct: 690 GNEEAVTALLD 700