BLASTX nr result
ID: Atractylodes21_contig00050712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00050712 (252 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65576.1| hypothetical protein VITISV_001034 [Vitis vinifera] 59 5e-07 >emb|CAN65576.1| hypothetical protein VITISV_001034 [Vitis vinifera] Length = 828 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/76 (38%), Positives = 53/76 (69%), Gaps = 1/76 (1%) Frame = +1 Query: 7 LKGLGREYQNYD-ISKILRTLPSE*MPKITSLEDSKDFSQMTLEDLHENLKLHEINLKKT 183 LK LG+ Y+ D + KILR+LPS+ K+T+++++KD +++ +E+L +L +EINL K Sbjct: 693 LKALGKTYKESDKVMKILRSLPSKWHKKVTTIQEAKDLTKLPMEELIGSLMTYEINLAKK 752 Query: 184 KLQG*NNLQVCISVEA 231 +G + + CI+++A Sbjct: 753 LQEGEDKKKKCITIKA 768