BLASTX nr result
ID: Atractylodes21_contig00050537
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00050537 (286 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514354.1| conserved hypothetical protein [Ricinus comm... 65 6e-09 >ref|XP_002514354.1| conserved hypothetical protein [Ricinus communis] gi|223546810|gb|EEF48308.1| conserved hypothetical protein [Ricinus communis] Length = 117 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 84 MEIRVFVPPDRPDRYWMIIRVKPGEVKKVLTKKLCDWE 197 MEIRVFVPPDRPDR+ IIR+KPGE K++L K CDW+ Sbjct: 1 MEIRVFVPPDRPDRFRKIIRIKPGENKEILVKSFCDWD 38