BLASTX nr result
ID: Atractylodes21_contig00050351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00050351 (270 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_177102.1| uncharacterized protein [Arabidopsis thaliana] ... 56 3e-06 ref|XP_002887236.1| predicted protein [Arabidopsis lyrata subsp.... 56 3e-06 >ref|NP_177102.1| uncharacterized protein [Arabidopsis thaliana] gi|12597781|gb|AAG60093.1|AC073178_4 unknown protein [Arabidopsis thaliana] gi|61742552|gb|AAX55097.1| hypothetical protein At1g69430 [Arabidopsis thaliana] gi|71905467|gb|AAZ52711.1| hypothetical protein At1g69430 [Arabidopsis thaliana] gi|332196803|gb|AEE34924.1| uncharacterized protein [Arabidopsis thaliana] Length = 350 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = +1 Query: 154 SDRLFRCTGALEILRETTRILRYNLSAFMAIAAVLICPV 270 SD F ALEILRET RILRYNL AFM IA +LICPV Sbjct: 34 SDHKFHSMNALEILRETVRILRYNLGAFMLIALLLICPV 72 >ref|XP_002887236.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297333077|gb|EFH63495.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 348 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = +1 Query: 154 SDRLFRCTGALEILRETTRILRYNLSAFMAIAAVLICPV 270 SD F ALEILRET RILRYNL AFM IA +LICPV Sbjct: 32 SDHQFHSMNALEILRETVRILRYNLGAFMLIALLLICPV 70