BLASTX nr result
ID: Atractylodes21_contig00050328
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00050328 (299 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003550682.1| PREDICTED: pentatricopeptide repeat-containi... 75 6e-12 emb|CBI36552.3| unnamed protein product [Vitis vinifera] 75 6e-12 ref|XP_002275298.1| PREDICTED: pentatricopeptide repeat-containi... 75 6e-12 ref|XP_003610281.1| Pentatricopeptide repeat-containing protein ... 75 6e-12 ref|XP_002309359.1| predicted protein [Populus trichocarpa] gi|2... 74 2e-11 >ref|XP_003550682.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like [Glycine max] Length = 778 Score = 75.1 bits (183), Expect = 6e-12 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 4 TKFVSKITERVIVVRDANRFHHFKDGRCSCGDYW 105 TKF+SKITERVIVVRDANRFHHFKDG CSCGDYW Sbjct: 745 TKFISKITERVIVVRDANRFHHFKDGICSCGDYW 778 >emb|CBI36552.3| unnamed protein product [Vitis vinifera] Length = 726 Score = 75.1 bits (183), Expect = 6e-12 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 4 TKFVSKITERVIVVRDANRFHHFKDGRCSCGDYW 105 TKF+SKITERVIVVRDANRFHHFKDG CSCGDYW Sbjct: 693 TKFISKITERVIVVRDANRFHHFKDGICSCGDYW 726 >ref|XP_002275298.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 [Vitis vinifera] Length = 781 Score = 75.1 bits (183), Expect = 6e-12 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 4 TKFVSKITERVIVVRDANRFHHFKDGRCSCGDYW 105 TKF+SKITERVIVVRDANRFHHFKDG CSCGDYW Sbjct: 748 TKFISKITERVIVVRDANRFHHFKDGICSCGDYW 781 >ref|XP_003610281.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355511336|gb|AES92478.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 783 Score = 75.1 bits (183), Expect = 6e-12 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 4 TKFVSKITERVIVVRDANRFHHFKDGRCSCGDYW 105 TKF+SKITERVIVVRDANRFHHFKDG CSCGDYW Sbjct: 750 TKFISKITERVIVVRDANRFHHFKDGICSCGDYW 783 >ref|XP_002309359.1| predicted protein [Populus trichocarpa] gi|222855335|gb|EEE92882.1| predicted protein [Populus trichocarpa] Length = 605 Score = 73.6 bits (179), Expect = 2e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 1 FTKFVSKITERVIVVRDANRFHHFKDGRCSCGDYW 105 +TKF+SKIT+RVIVVRDANRFHHFKDG CSCGDYW Sbjct: 571 WTKFLSKITKRVIVVRDANRFHHFKDGLCSCGDYW 605