BLASTX nr result
ID: Atractylodes21_contig00050164
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00050164 (399 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACX33887.1| flavin monooxygenase-like protein [Solanum lycope... 65 8e-09 ref|XP_002518191.1| monooxygenase, putative [Ricinus communis] g... 60 2e-07 ref|XP_004152071.1| PREDICTED: flavin-containing monooxygenase Y... 59 3e-07 ref|XP_004170806.1| PREDICTED: LOW QUALITY PROTEIN: flavin-conta... 59 4e-07 ref|XP_002314526.1| flavine-containing monoxygenase [Populus tri... 59 4e-07 >gb|ACX33887.1| flavin monooxygenase-like protein [Solanum lycopersicum] Length = 431 Score = 64.7 bits (156), Expect = 8e-09 Identities = 30/54 (55%), Positives = 35/54 (64%) Frame = -3 Query: 379 PKTPFSNGWKGKCGLYAAGFTKRGLQVLLLTP*KYLKMLPKFWKEELNLKKQKV 218 P++PF NGWKGK GLYA GFTKRGL L K + + K WKEE+ K Q V Sbjct: 365 PRSPFPNGWKGKAGLYAVGFTKRGLSGASLDAIKVSQDIGKIWKEEIKQKNQSV 418 >ref|XP_002518191.1| monooxygenase, putative [Ricinus communis] gi|223542787|gb|EEF44324.1| monooxygenase, putative [Ricinus communis] Length = 421 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/54 (53%), Positives = 32/54 (59%) Frame = -3 Query: 379 PKTPFSNGWKGKCGLYAAGFTKRGLQVLLLTP*KYLKMLPKFWKEELNLKKQKV 218 PK PF NGWKGK GLYA GFT+RGL L + K WKEE KK+ V Sbjct: 357 PKNPFPNGWKGKAGLYAVGFTRRGLSGASLDAISVALDIAKSWKEETKQKKKTV 410 >ref|XP_004152071.1| PREDICTED: flavin-containing monooxygenase YUCCA8-like [Cucumis sativus] Length = 418 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/58 (46%), Positives = 35/58 (60%) Frame = -3 Query: 391 KTAPPKTPFSNGWKGKCGLYAAGFTKRGLQVLLLTP*KYLKMLPKFWKEELNLKKQKV 218 K PKTPF NGWKGK GLYA GFT+RGL + K + + W++E KK+ + Sbjct: 351 KNGFPKTPFPNGWKGKSGLYAVGFTRRGLSGVTSDAIKIAQDIGNVWRQETKQKKKPI 408 >ref|XP_004170806.1| PREDICTED: LOW QUALITY PROTEIN: flavin-containing monooxygenase YUCCA8-like [Cucumis sativus] Length = 419 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/58 (46%), Positives = 34/58 (58%) Frame = -3 Query: 391 KTAPPKTPFSNGWKGKCGLYAAGFTKRGLQVLLLTP*KYLKMLPKFWKEELNLKKQKV 218 K PKTPF NGWKGK GLYA GFT+RGL + K + + W++E KK + Sbjct: 352 KNGFPKTPFPNGWKGKSGLYAVGFTRRGLSGVTSDAIKIAQDIGNVWRQETKQKKNXI 409 >ref|XP_002314526.1| flavine-containing monoxygenase [Populus trichocarpa] gi|222863566|gb|EEF00697.1| flavine-containing monoxygenase [Populus trichocarpa] Length = 422 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/54 (51%), Positives = 31/54 (57%) Frame = -3 Query: 379 PKTPFSNGWKGKCGLYAAGFTKRGLQVLLLTP*KYLKMLPKFWKEELNLKKQKV 218 PK PF NGWKG GLYA GFT+RGL L + K WKEE KK+ V Sbjct: 358 PKNPFPNGWKGNAGLYAVGFTRRGLSGASLDAMSVALDIAKIWKEETKQKKKTV 411