BLASTX nr result
ID: Atractylodes21_contig00050151
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00050151 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004222688.1| ribosomal protein L2 [Anthriscus cerefolium]... 58 9e-07 ref|YP_778531.1| ribosomal protein L2 [Jasminum nudiflorum] gi|1... 58 9e-07 ref|YP_007353829.1| ribosomal protein L2 (chloroplast) [Chrysant... 57 1e-06 ref|YP_007353808.1| ribosomal protein L2 (chloroplast) [Chrysant... 57 1e-06 ref|YP_087007.1| ribosomal protein L2 [Panax ginseng] gi|5222087... 57 1e-06 >ref|YP_004222688.1| ribosomal protein L2 [Anthriscus cerefolium] gi|323149146|ref|YP_004222709.1| ribosomal protein L2 [Anthriscus cerefolium] gi|289645617|gb|ADD13680.1| ribosomal protein L2 [Anthriscus cerefolium] gi|289645639|gb|ADD13702.1| ribosomal protein L2 [Anthriscus cerefolium] Length = 274 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/48 (56%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = +3 Query: 15 RTVDSQEKFNPRNNLIYEEHHCAEGRNGKGIITTSD-ASNYKRIE*KV 155 RTVDS+ K NPRNNLIY +HHC +GRN +GIIT +KR+ K+ Sbjct: 16 RTVDSRVKSNPRNNLIYGQHHCGKGRNARGIITAGHRGGGHKRLYRKI 63 >ref|YP_778531.1| ribosomal protein L2 [Jasminum nudiflorum] gi|115391968|ref|YP_778555.1| ribosomal protein L2 [Jasminum nudiflorum] gi|122164916|sp|Q06R66.1|RK2_JASNU RecName: Full=50S ribosomal protein L2, chloroplastic gi|110456263|gb|ABG74668.1| ribosomal protein L2 [Jasminum nudiflorum] gi|110456289|gb|ABG74694.1| ribosomal protein L2 [Jasminum nudiflorum] Length = 274 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +3 Query: 18 TVDSQEKFNPRNNLIYEEHHCAEGRNGKGIITT 116 TVDSQ K NPRNNLIY +HHC +GRN +G+ITT Sbjct: 17 TVDSQVKSNPRNNLIYGQHHCGKGRNARGVITT 49 >ref|YP_007353829.1| ribosomal protein L2 (chloroplast) [Chrysanthemum x morifolium] gi|372863508|gb|AEX99577.1| ribosomal protein L2 (chloroplast) [Chrysanthemum indicum] gi|375298899|gb|AFA45338.1| ribosomal protein L2 (chloroplast) [Chrysanthemum x morifolium] Length = 274 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 1/47 (2%) Frame = +3 Query: 18 TVDSQEKFNPRNNLIYEEHHCAEGRNGKGIITTSD-ASNYKRIE*KV 155 TVDSQ K NPRNNLIY +HHC +GRN +GIIT +KR+ K+ Sbjct: 17 TVDSQVKSNPRNNLIYGQHHCGKGRNARGIITAGHRGGGHKRLYRKI 63 >ref|YP_007353808.1| ribosomal protein L2 (chloroplast) [Chrysanthemum x morifolium] gi|452849093|ref|YP_007474771.1| ribosomal protein L2 (chloroplast) [Chrysanthemum indicum] gi|452849112|ref|YP_007474790.1| ribosomal protein L2 (chloroplast) [Chrysanthemum indicum] gi|372863248|gb|AEX99320.1| ribosomal protein L2 (chloroplast) [Chrysanthemum indicum] gi|372863267|gb|AEX99339.1| ribosomal protein L2 (chloroplast) [Chrysanthemum indicum] gi|372863487|gb|AEX99556.1| ribosomal protein L2 (chloroplast) [Chrysanthemum indicum] gi|375298878|gb|AFA45317.1| ribosomal protein L2 (chloroplast) [Chrysanthemum x morifolium] Length = 274 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 1/47 (2%) Frame = +3 Query: 18 TVDSQEKFNPRNNLIYEEHHCAEGRNGKGIITTSD-ASNYKRIE*KV 155 TVDSQ K NPRNNLIY +HHC +GRN +GIIT +KR+ K+ Sbjct: 17 TVDSQVKSNPRNNLIYGQHHCGKGRNARGIITAGHRGGGHKRLYRKI 63 >ref|YP_087007.1| ribosomal protein L2 [Panax ginseng] gi|52220876|ref|YP_087030.1| ribosomal protein L2 [Panax ginseng] gi|359422186|ref|YP_004935594.1| ribosomal protein L2 (chloroplast) [Eleutherococcus senticosus] gi|359422207|ref|YP_004935617.1| ribosomal protein L2 (chloroplast) [Eleutherococcus senticosus] gi|68052924|sp|Q68RU2.1|RK2_PANGI RecName: Full=50S ribosomal protein L2, chloroplastic gi|51235354|gb|AAT98550.1| ribosomal protein L2 [Panax ginseng] gi|51235379|gb|AAT98575.1| ribosomal protein L2 [Panax ginseng] gi|347448249|gb|AEO92661.1| ribosomal protein L2 (chloroplast) [Eleutherococcus senticosus] gi|347448270|gb|AEO92682.1| ribosomal protein L2 (chloroplast) [Eleutherococcus senticosus] Length = 274 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/48 (56%), Positives = 33/48 (68%), Gaps = 1/48 (2%) Frame = +3 Query: 15 RTVDSQEKFNPRNNLIYEEHHCAEGRNGKGIITTSD-ASNYKRIE*KV 155 R VDSQ K NPRNNLIY +HHC +GRN +GIIT +KR+ K+ Sbjct: 16 RAVDSQVKSNPRNNLIYGQHHCGKGRNARGIITAGHRGGGHKRLYRKI 63