BLASTX nr result
ID: Atractylodes21_contig00050050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00050050 (397 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533213.1| conserved hypothetical protein [Ricinus comm... 74 1e-11 >ref|XP_002533213.1| conserved hypothetical protein [Ricinus communis] gi|223526970|gb|EEF29166.1| conserved hypothetical protein [Ricinus communis] Length = 332 Score = 74.3 bits (181), Expect = 1e-11 Identities = 39/121 (32%), Positives = 66/121 (54%) Frame = -1 Query: 364 LSGFLELLKGPLKILSGNGKLIAFTATLYIIFNSISFILYTYSSNPFIIDFVIKLFALVS 185 L GF +L+ LK+ NG+++A A ++ SI ++ T+S+ P I D +++ L Sbjct: 6 LLGFAGVLRDALKVFCKNGRIMASVALFTLLTKSILYLSITFSTKPLITDLLVERNLLHV 65 Query: 184 ARPGTPEYTKLLVAIREDIGIVLGIAIAYGVLNFFIVVFTETAVIITASCYYNGDYNLST 5 P TPE+T +L IR+D I G+ Y +L+ + + TA I+ A+ + G +LS Sbjct: 66 TTPNTPEFTNILAHIRKDFKIFYGLECIYVILDAVTFLLSATATILAAAIIHGGKDDLSL 125 Query: 4 K 2 K Sbjct: 126 K 126