BLASTX nr result
ID: Atractylodes21_contig00048998
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00048998 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF82236.1|AC069143_12 Contains similarity to a transposable ... 100 1e-19 ref|NP_173360.1| TTF-type zinc finger protein with HAT dimerizat... 100 1e-19 ref|NP_192704.1| uncharacterized protein [Arabidopsis thaliana] ... 99 4e-19 ref|XP_002319808.1| predicted protein [Populus trichocarpa] gi|2... 98 6e-19 ref|XP_003589867.1| hypothetical protein MTR_1g040620 [Medicago ... 96 4e-18 >gb|AAF82236.1|AC069143_12 Contains similarity to a transposable element Tip100 protein for transposase from Ipomoea purpurea gb|4063769 and is a member of the transmembrane 4 family PF|00335 [Arabidopsis thaliana] Length = 811 Score = 100 bits (249), Expect = 1e-19 Identities = 46/75 (61%), Positives = 51/75 (68%) Frame = -2 Query: 227 DINLNELPADPGLRIRILDYNANIRDGVRRSYLLKGPCQPRNHEFPYTIFWSKSRRFNPA 48 DINLNELP+DP R IL Y+ N RD VRR YL++GPCQPR H+F RRFNP Sbjct: 56 DINLNELPSDPAKRKSILSYHPNQRDEVRREYLIRGPCQPRGHKFKQIAIGKVLRRFNPK 115 Query: 47 WFDEYSTWLEYSVSK 3 WFD Y WLEYSV K Sbjct: 116 WFDLYGDWLEYSVEK 130 >ref|NP_173360.1| TTF-type zinc finger protein with HAT dimerization domain [Arabidopsis thaliana] gi|332191703|gb|AEE29824.1| TTF-type zinc finger protein with HAT dimerization domain [Arabidopsis thaliana] Length = 769 Score = 100 bits (249), Expect = 1e-19 Identities = 46/75 (61%), Positives = 51/75 (68%) Frame = -2 Query: 227 DINLNELPADPGLRIRILDYNANIRDGVRRSYLLKGPCQPRNHEFPYTIFWSKSRRFNPA 48 DINLNELP+DP R IL Y+ N RD VRR YL++GPCQPR H+F RRFNP Sbjct: 14 DINLNELPSDPAKRKSILSYHPNQRDEVRREYLIRGPCQPRGHKFKQIAIGKVLRRFNPK 73 Query: 47 WFDEYSTWLEYSVSK 3 WFD Y WLEYSV K Sbjct: 74 WFDLYGDWLEYSVEK 88 >ref|NP_192704.1| uncharacterized protein [Arabidopsis thaliana] gi|4538896|emb|CAB39633.1| putative protein [Arabidopsis thaliana] gi|7267661|emb|CAB78089.1| putative protein [Arabidopsis thaliana] gi|332657378|gb|AEE82778.1| uncharacterized protein [Arabidopsis thaliana] Length = 664 Score = 99.0 bits (245), Expect = 4e-19 Identities = 44/75 (58%), Positives = 51/75 (68%) Frame = -2 Query: 227 DINLNELPADPGLRIRILDYNANIRDGVRRSYLLKGPCQPRNHEFPYTIFWSKSRRFNPA 48 DIN N+LP+DP R IL Y+ N RD VRR YL++GPCQPR H+F + RRFNP Sbjct: 14 DINFNKLPSDPAKRKSILSYHLNQRDEVRREYLIRGPCQPRGHKFKQIVIGKVLRRFNPK 73 Query: 47 WFDEYSTWLEYSVSK 3 WFD Y WLEYSV K Sbjct: 74 WFDLYGDWLEYSVEK 88 >ref|XP_002319808.1| predicted protein [Populus trichocarpa] gi|222858184|gb|EEE95731.1| predicted protein [Populus trichocarpa] Length = 788 Score = 98.2 bits (243), Expect = 6e-19 Identities = 52/104 (50%), Positives = 67/104 (64%), Gaps = 8/104 (7%) Frame = -2 Query: 290 KRKTVVDPENKNVEGF------KQSRIDINLNELPADPGLRIRILDYNANIRDGVRRSYL 129 KRK++ D E+ K+S I+IN + L ADPGLR I +Y+ N RD +RR+YL Sbjct: 8 KRKSLEDEESIKASSHVTQSSSKKSHIEINPDTLLADPGLRRPIYEYHINDRDAIRRAYL 67 Query: 128 LKGPCQPRNHEFPYTIFWSKS--RRFNPAWFDEYSTWLEYSVSK 3 KGPCQP + +FP F + S RRFNPAWF Y TWLEYS++K Sbjct: 68 QKGPCQPSHCDFPQKQFGNISTLRRFNPAWFGAYPTWLEYSIAK 111 >ref|XP_003589867.1| hypothetical protein MTR_1g040620 [Medicago truncatula] gi|355478915|gb|AES60118.1| hypothetical protein MTR_1g040620 [Medicago truncatula] Length = 665 Score = 95.5 bits (236), Expect = 4e-18 Identities = 42/81 (51%), Positives = 57/81 (70%) Frame = -2 Query: 245 FKQSRIDINLNELPADPGLRIRILDYNANIRDGVRRSYLLKGPCQPRNHEFPYTIFWSKS 66 FK ++++L LPA+PG R ++ Y+ N RD +RR+YL KGPCQP+ H FP F + Sbjct: 32 FKNGFLEVDLENLPANPGERKQLSCYHPNDRDEIRRAYLAKGPCQPKEHNFPQRPFGTFL 91 Query: 65 RRFNPAWFDEYSTWLEYSVSK 3 R+FNP WF E+ +WLEYSVSK Sbjct: 92 RKFNPDWFLEFGSWLEYSVSK 112