BLASTX nr result
ID: Atractylodes21_contig00048909
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00048909 (429 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT40504.2| Polyprotein, putative [Solanum demissum] 57 2e-06 gb|AAT40500.1| Putative reverse transcriptase, identical [Solanu... 56 3e-06 >gb|AAT40504.2| Polyprotein, putative [Solanum demissum] Length = 868 Score = 56.6 bits (135), Expect = 2e-06 Identities = 35/89 (39%), Positives = 47/89 (52%) Frame = +3 Query: 3 YGSEC*PVKKV*ERKLELAKKRMLRYMYGRTLLNKIPNGVFR*EL*VVSITDKL*GGRF* 182 YG+EC PVK K+ +A+ RMLR+M G T +KI N V R ++ V S+ DKL R Sbjct: 564 YGAECWPVKNAHVHKMHVAEMRMLRWMCGHTRSDKIRNEVIREKVGVASVVDKLREARLR 623 Query: 183 *CGHIKEETQYDAGTRVENMTVGDEEDGQ 269 GH+K + R E M V G+ Sbjct: 624 WFGHVKRRSADAPVRRCEVMVVEGTRRGR 652 >gb|AAT40500.1| Putative reverse transcriptase, identical [Solanum demissum] Length = 213 Score = 56.2 bits (134), Expect = 3e-06 Identities = 34/82 (41%), Positives = 45/82 (54%) Frame = +3 Query: 3 YGSEC*PVKKV*ERKLELAKKRMLRYMYGRTLLNKIPNGVFR*EL*VVSITDKL*GGRF* 182 YG+EC PVK K+ +A+ RMLR+M G T +KI N V R ++ V S+ DKL R Sbjct: 96 YGAECWPVKNAHVHKMHVAEMRMLRWMCGHTRSDKIRNEVIREKVGVASVVDKLREARLR 155 Query: 183 *CGHIKEETQYDAGTRVENMTV 248 GH+K + R E M V Sbjct: 156 WFGHVKRRSADAPVRRCEVMVV 177