BLASTX nr result
ID: Atractylodes21_contig00048901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00048901 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002450522.1| hypothetical protein SORBIDRAFT_05g006540 [S... 67 2e-09 ref|XP_002524580.1| conserved hypothetical protein [Ricinus comm... 66 3e-09 gb|EEE51938.1| hypothetical protein OsJ_33565 [Oryza sativa Japo... 66 3e-09 gb|EEC67970.1| hypothetical protein OsI_35724 [Oryza sativa Indi... 65 8e-09 ref|NP_001144168.1| uncharacterized protein LOC100277023 [Zea ma... 65 8e-09 >ref|XP_002450522.1| hypothetical protein SORBIDRAFT_05g006540 [Sorghum bicolor] gi|241936365|gb|EES09510.1| hypothetical protein SORBIDRAFT_05g006540 [Sorghum bicolor] Length = 124 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +3 Query: 141 MSQADVSYSCGSCGYPLNLASSNRRASEIGSKYSKSIRK 257 MSQ DV YSCGSCGYPLNL+SSNR SE+GS Y KS++K Sbjct: 1 MSQRDVDYSCGSCGYPLNLSSSNRSTSEVGSSYKKSLKK 39 >ref|XP_002524580.1| conserved hypothetical protein [Ricinus communis] gi|223536133|gb|EEF37788.1| conserved hypothetical protein [Ricinus communis] Length = 122 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +3 Query: 141 MSQADVSYSCGSCGYPLNLASSNRRASEIGSKYSKSIRK 257 MSQADVSYSCGSCGYPLNL+SSNR S I S+Y KSI+K Sbjct: 1 MSQADVSYSCGSCGYPLNLSSSNRITSSIDSEYRKSIKK 39 >gb|EEE51938.1| hypothetical protein OsJ_33565 [Oryza sativa Japonica Group] Length = 123 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +3 Query: 141 MSQADVSYSCGSCGYPLNLASSNRRASEIGSKYSKSIRK 257 MSQ+DV YSCGSCGYPLNL+SSNR S++GS Y KS++K Sbjct: 1 MSQSDVVYSCGSCGYPLNLSSSNRSTSDVGSSYQKSVKK 39 >gb|EEC67970.1| hypothetical protein OsI_35724 [Oryza sativa Indica Group] Length = 123 Score = 64.7 bits (156), Expect = 8e-09 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +3 Query: 141 MSQADVSYSCGSCGYPLNLASSNRRASEIGSKYSKSIRK 257 MSQ+DV YSCGSCGYPLNL+SSNR S +GS Y KS++K Sbjct: 1 MSQSDVVYSCGSCGYPLNLSSSNRSTSGVGSSYQKSVKK 39 >ref|NP_001144168.1| uncharacterized protein LOC100277023 [Zea mays] gi|195637898|gb|ACG38417.1| hypothetical protein [Zea mays] Length = 124 Score = 64.7 bits (156), Expect = 8e-09 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 141 MSQADVSYSCGSCGYPLNLASSNRRASEIGSKYSKSIRK 257 MSQ DV YSCG CGYPLNL+SSNR SE+GS Y KS++K Sbjct: 1 MSQRDVDYSCGFCGYPLNLSSSNRSTSEVGSSYKKSLKK 39