BLASTX nr result
ID: Atractylodes21_contig00048718
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00048718 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264078.2| PREDICTED: pentatricopeptide repeat-containi... 111 5e-23 ref|XP_004141609.1| PREDICTED: pentatricopeptide repeat-containi... 111 7e-23 ref|XP_002529628.1| pentatricopeptide repeat-containing protein,... 103 1e-20 ref|XP_003549152.1| PREDICTED: pentatricopeptide repeat-containi... 92 4e-17 ref|XP_002338705.1| predicted protein [Populus trichocarpa] gi|2... 91 1e-16 >ref|XP_002264078.2| PREDICTED: pentatricopeptide repeat-containing protein At1g33350-like [Vitis vinifera] Length = 573 Score = 111 bits (278), Expect = 5e-23 Identities = 51/78 (65%), Positives = 64/78 (82%) Frame = -3 Query: 234 DMVRNKRPKVSHFIYPHVLKSCPEVLGSNGTKMVHTQIVRTGYHEYPVVQTALLDAYSRF 55 +MVR +RP +HFIYPHVLKSC +V+G +MVH Q++R+G+ +YPVVQTALLDAY RF Sbjct: 144 NMVRRRRPWPNHFIYPHVLKSCTQVVGPGSARMVHCQVLRSGFEQYPVVQTALLDAYLRF 203 Query: 54 SSDIGVARLLFDEMSERN 1 SD+ ARLLFDEM+ERN Sbjct: 204 WSDVESARLLFDEMTERN 221 >ref|XP_004141609.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350-like [Cucumis sativus] gi|449510706|ref|XP_004163739.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350-like [Cucumis sativus] Length = 563 Score = 111 bits (277), Expect = 7e-23 Identities = 51/77 (66%), Positives = 66/77 (85%) Frame = -3 Query: 234 DMVRNKRPKVSHFIYPHVLKSCPEVLGSNGTKMVHTQIVRTGYHEYPVVQTALLDAYSRF 55 +MVR + ++FIYPHVL+SCP+VLGSN TKMVHTQ++++G+ YPVVQTA++D+YSRF Sbjct: 132 NMVRRGAIRPNNFIYPHVLRSCPDVLGSNATKMVHTQVLKSGFGGYPVVQTAIVDSYSRF 191 Query: 54 SSDIGVARLLFDEMSER 4 SSDIG AR +FDEM ER Sbjct: 192 SSDIGSARQMFDEMLER 208 >ref|XP_002529628.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530913|gb|EEF32773.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 400 Score = 103 bits (257), Expect = 1e-20 Identities = 50/78 (64%), Positives = 60/78 (76%) Frame = -3 Query: 234 DMVRNKRPKVSHFIYPHVLKSCPEVLGSNGTKMVHTQIVRTGYHEYPVVQTALLDAYSRF 55 DMVR PK +HFI+PHVLKSC TK+VH+QI + G+ +YPVVQTAL+D+YSRF Sbjct: 99 DMVRRAHPKPNHFIFPHVLKSC------QNTKVVHSQIAKLGFSQYPVVQTALVDSYSRF 152 Query: 54 SSDIGVARLLFDEMSERN 1 SDIG AR +FDEMSERN Sbjct: 153 MSDIGCARQVFDEMSERN 170 >ref|XP_003549152.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350-like [Glycine max] Length = 522 Score = 92.0 bits (227), Expect = 4e-17 Identities = 41/77 (53%), Positives = 61/77 (79%) Frame = -3 Query: 231 MVRNKRPKVSHFIYPHVLKSCPEVLGSNGTKMVHTQIVRTGYHEYPVVQTALLDAYSRFS 52 M+R++ P+ +HFI+PH LK+CPE S + +H QIV++G+HEYPVVQTAL+D+YS+ S Sbjct: 97 MLRSQPPRPNHFIFPHALKTCPE---SCAAESLHAQIVKSGFHEYPVVQTALVDSYSKVS 153 Query: 51 SDIGVARLLFDEMSERN 1 +G A+ +FDEMS+R+ Sbjct: 154 GGLGNAKKVFDEMSDRS 170 >ref|XP_002338705.1| predicted protein [Populus trichocarpa] gi|222873268|gb|EEF10399.1| predicted protein [Populus trichocarpa] Length = 263 Score = 90.9 bits (224), Expect = 1e-16 Identities = 44/77 (57%), Positives = 55/77 (71%) Frame = -3 Query: 231 MVRNKRPKVSHFIYPHVLKSCPEVLGSNGTKMVHTQIVRTGYHEYPVVQTALLDAYSRFS 52 M+R PK +HF++PHVLK C TK VH QI + G+ +YPVVQTAL+D+YSR Sbjct: 21 MLRRGHPKPNHFLFPHVLKYCQV------TKFVHAQIEKLGFGQYPVVQTALIDSYSRSG 74 Query: 51 SDIGVARLLFDEMSERN 1 DIG+AR +FDEMSERN Sbjct: 75 YDIGIARRMFDEMSERN 91