BLASTX nr result
ID: Atractylodes21_contig00048635
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00048635 (346 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCH50976.1| T4.15 [Malus x robusta] 78 9e-13 emb|CBL94163.1| putative RNA-directed DNA polymerase (Reverse tr... 72 5e-11 gb|ABB00038.1| reverse transcriptase family member [Glycine max] 71 8e-11 emb|CCH50954.1| T1.2 [Malus x robusta] 68 9e-10 gb|AEL30343.1| RNA-directed DNA polymerase [Arachis hypogaea] 66 3e-09 >emb|CCH50976.1| T4.15 [Malus x robusta] Length = 986 Score = 77.8 bits (190), Expect = 9e-13 Identities = 34/54 (62%), Positives = 44/54 (81%) Frame = +1 Query: 1 PGRSTIQTIHLLRRLMEKYHYRSKDLHMVFIELEKAYDGMPRELIWWFPEDRGC 162 PGRST++ I+LLRRLME+Y KDLHMVFI+LEKAYD +PR+++W E +GC Sbjct: 673 PGRSTMEAIYLLRRLMERYRDGKKDLHMVFIDLEKAYDRVPRDILWRILEKKGC 726 >emb|CBL94163.1| putative RNA-directed DNA polymerase (Reverse transcriptase) [Malus x domestica] Length = 622 Score = 72.0 bits (175), Expect = 5e-11 Identities = 33/53 (62%), Positives = 42/53 (79%) Frame = +1 Query: 1 PGRSTIQTIHLLRRLMEKYHYRSKDLHMVFIELEKAYDGMPRELIWWFPEDRG 159 PGRST++ I+LLRRLME+Y KDLHMVFI+LEKAYD + R++IW E +G Sbjct: 277 PGRSTMEAIYLLRRLMERYRDGKKDLHMVFIDLEKAYDRVSRDIIWRILEKKG 329 >gb|ABB00038.1| reverse transcriptase family member [Glycine max] Length = 377 Score = 71.2 bits (173), Expect = 8e-11 Identities = 30/53 (56%), Positives = 43/53 (81%) Frame = +1 Query: 1 PGRSTIQTIHLLRRLMEKYHYRSKDLHMVFIELEKAYDGMPRELIWWFPEDRG 159 PGRST++ I+LLRR+ME+Y +DLH++FI+LEKAYD +PRE++W E +G Sbjct: 2 PGRSTMEAIYLLRRVMEQYRMAQQDLHLIFIDLEKAYDRVPREILWKALEKKG 54 >emb|CCH50954.1| T1.2 [Malus x robusta] Length = 554 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/53 (56%), Positives = 40/53 (75%) Frame = +1 Query: 1 PGRSTIQTIHLLRRLMEKYHYRSKDLHMVFIELEKAYDGMPRELIWWFPEDRG 159 PG ST++ I+LLR+LMEKY DLHMVFI+LEK YD +PR+++W E +G Sbjct: 296 PGCSTMEAIYLLRKLMEKYRDGKNDLHMVFIDLEKVYDRVPRDILWRILEKKG 348 >gb|AEL30343.1| RNA-directed DNA polymerase [Arachis hypogaea] Length = 562 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = +1 Query: 4 GRSTIQTIHLLRRLMEKYHYRSKDLHMVFIELEKAYDGMPRELIW 138 GRS + I+LLRR+ME+Y +DLHMVFI+LEKAYD +PRE++W Sbjct: 168 GRSITEAIYLLRRMMERYRSNKRDLHMVFIDLEKAYDRVPREVLW 212