BLASTX nr result
ID: Atractylodes21_contig00048606
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00048606 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268160.2| PREDICTED: probable LRR receptor-like serine... 64 2e-08 emb|CAN66019.1| hypothetical protein VITISV_031856 [Vitis vinifera] 64 2e-08 ref|XP_002521090.1| kinase, putative [Ricinus communis] gi|22353... 62 4e-08 ref|XP_002301786.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 ref|NP_199685.2| putative LRR receptor-like serine/threonine-pro... 57 1e-06 >ref|XP_002268160.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At5g48740-like [Vitis vinifera] gi|297744356|emb|CBI37326.3| unnamed protein product [Vitis vinifera] Length = 905 Score = 63.5 bits (153), Expect = 2e-08 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -2 Query: 206 AASIASRSVDRDASQRPNIAEVLAALKEAYSSQLSYLATVGH 81 AA IASRSV+RDA+QRP +AEVLA LKEAYS QLSYLA+ GH Sbjct: 862 AALIASRSVERDAAQRPVMAEVLAELKEAYSIQLSYLASCGH 903 >emb|CAN66019.1| hypothetical protein VITISV_031856 [Vitis vinifera] Length = 859 Score = 63.5 bits (153), Expect = 2e-08 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -2 Query: 206 AASIASRSVDRDASQRPNIAEVLAALKEAYSSQLSYLATVGH 81 AA IASRSV+RDA+QRP +AEVLA LKEAYS QLSYLA+ GH Sbjct: 816 AALIASRSVERDAAQRPVMAEVLAELKEAYSIQLSYLASCGH 857 >ref|XP_002521090.1| kinase, putative [Ricinus communis] gi|223539659|gb|EEF41241.1| kinase, putative [Ricinus communis] Length = 903 Score = 62.4 bits (150), Expect = 4e-08 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -2 Query: 206 AASIASRSVDRDASQRPNIAEVLAALKEAYSSQLSYLA 93 AA++A+RSV+RDASQRPNIAEVLA LKEAY+ QLSYLA Sbjct: 862 AAAVAARSVERDASQRPNIAEVLAELKEAYNIQLSYLA 899 >ref|XP_002301786.1| predicted protein [Populus trichocarpa] gi|222843512|gb|EEE81059.1| predicted protein [Populus trichocarpa] Length = 307 Score = 57.8 bits (138), Expect = 9e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 206 AASIASRSVDRDASQRPNIAEVLAALKEAYSSQLSYLAT 90 AA +A RSV+RDASQRP IAEVLA LKEAYS QLS+LA+ Sbjct: 266 AAIVAVRSVERDASQRPTIAEVLAELKEAYSIQLSFLAS 304 >ref|NP_199685.2| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] gi|264664537|sp|C0LGV0.1|Y5487_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein kinase At5g48740; Flags: Precursor gi|224589707|gb|ACN59385.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gi|332008335|gb|AED95718.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] Length = 895 Score = 57.4 bits (137), Expect = 1e-06 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = -2 Query: 206 AASIASRSVDRDASQRPNIAEVLAALKEAYSSQLSYLATVGHS 78 AASIA R V RDAS RP+IAEVL LKEAYS QLSYLA H+ Sbjct: 852 AASIAIRCVGRDASGRPSIAEVLTKLKEAYSLQLSYLAASAHT 894