BLASTX nr result
ID: Atractylodes21_contig00048519
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00048519 (278 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAZ14299.1| hypothetical protein OsJ_04225 [Oryza sativa Japo... 75 7e-12 ref|XP_002448079.1| hypothetical protein SORBIDRAFT_06g020630 [S... 70 1e-10 ref|XP_002446690.1| hypothetical protein SORBIDRAFT_06g020633 [S... 70 1e-10 ref|XP_002437451.1| hypothetical protein SORBIDRAFT_10g027335 [S... 70 1e-10 ref|XP_002437196.1| hypothetical protein SORBIDRAFT_10g022742 [S... 70 1e-10 >gb|EAZ14299.1| hypothetical protein OsJ_04225 [Oryza sativa Japonica Group] Length = 357 Score = 74.7 bits (182), Expect = 7e-12 Identities = 37/87 (42%), Positives = 53/87 (60%) Frame = -1 Query: 275 IKLHQLGKY*VVEFIAKHTHVNASPCMSHLHRSQRRITLAQASEIELAENSGIAPKVSRE 96 IK+ GKY + F H H +P +HL RSQRR+T AQ ++I++ +SG+ PK E Sbjct: 115 IKITPTGKYAIASFSNTHNHELITPSKAHLLRSQRRMTEAQKAQIDILNDSGVRPKEGHE 174 Query: 95 LMTRQGGVHANLEFILDDCRNYLSTKR 15 +M+RQ G +L F D +NYL +KR Sbjct: 175 VMSRQAGGRQSLTFTRKDYKNYLRSKR 201 >ref|XP_002448079.1| hypothetical protein SORBIDRAFT_06g020630 [Sorghum bicolor] gi|241939262|gb|EES12407.1| hypothetical protein SORBIDRAFT_06g020630 [Sorghum bicolor] Length = 450 Score = 70.5 bits (171), Expect = 1e-10 Identities = 38/85 (44%), Positives = 50/85 (58%) Frame = -1 Query: 257 GKY*VVEFIAKHTHVNASPCMSHLHRSQRRITLAQASEIELAENSGIAPKVSRELMTRQG 78 G Y V + I +H H+ P SHL SQR+I+ Q EIE A+N+GI PK + EL + Q Sbjct: 74 GNYKVTDVILEHNHILQLPQASHLLASQRKISELQGFEIETADNAGIGPKAAHELASIQV 133 Query: 77 GVHANLEFILDDCRNYLSTKRTIQM 3 G NL + L D +NYL KR +M Sbjct: 134 GGSHNLSYTLRDHKNYLRAKRQREM 158 >ref|XP_002446690.1| hypothetical protein SORBIDRAFT_06g020633 [Sorghum bicolor] gi|241937873|gb|EES11018.1| hypothetical protein SORBIDRAFT_06g020633 [Sorghum bicolor] Length = 340 Score = 70.5 bits (171), Expect = 1e-10 Identities = 38/85 (44%), Positives = 50/85 (58%) Frame = -1 Query: 257 GKY*VVEFIAKHTHVNASPCMSHLHRSQRRITLAQASEIELAENSGIAPKVSRELMTRQG 78 G Y V + I +H H+ P SHL SQR+I+ Q EIE A+N+GI PK + EL + Q Sbjct: 52 GNYKVTDVILEHNHILQLPQASHLLASQRKISELQGFEIETADNAGIGPKAAHELASIQV 111 Query: 77 GVHANLEFILDDCRNYLSTKRTIQM 3 G NL + L D +NYL KR +M Sbjct: 112 GGSHNLSYTLRDHKNYLRAKRQREM 136 >ref|XP_002437451.1| hypothetical protein SORBIDRAFT_10g027335 [Sorghum bicolor] gi|241915674|gb|EER88818.1| hypothetical protein SORBIDRAFT_10g027335 [Sorghum bicolor] Length = 630 Score = 70.5 bits (171), Expect = 1e-10 Identities = 38/85 (44%), Positives = 50/85 (58%) Frame = -1 Query: 257 GKY*VVEFIAKHTHVNASPCMSHLHRSQRRITLAQASEIELAENSGIAPKVSRELMTRQG 78 G Y V + I +H H+ P SHL SQR+I+ Q EIE A+N+GI PK + EL + Q Sbjct: 36 GNYKVTDVILEHNHILQLPQASHLLASQRKISELQGFEIETADNAGIGPKAAHELASIQV 95 Query: 77 GVHANLEFILDDCRNYLSTKRTIQM 3 G NL + L D +NYL KR +M Sbjct: 96 GGSHNLSYTLRDHKNYLRAKRQREM 120 >ref|XP_002437196.1| hypothetical protein SORBIDRAFT_10g022742 [Sorghum bicolor] gi|241915419|gb|EER88563.1| hypothetical protein SORBIDRAFT_10g022742 [Sorghum bicolor] Length = 420 Score = 70.5 bits (171), Expect = 1e-10 Identities = 38/85 (44%), Positives = 50/85 (58%) Frame = -1 Query: 257 GKY*VVEFIAKHTHVNASPCMSHLHRSQRRITLAQASEIELAENSGIAPKVSRELMTRQG 78 G Y V + I +H H+ P SHL SQR+I+ Q EIE A+N+GI PK + EL + Q Sbjct: 88 GNYKVTDVILEHNHILQLPQASHLLASQRKISELQGFEIETADNAGIGPKAAHELASIQV 147 Query: 77 GVHANLEFILDDCRNYLSTKRTIQM 3 G NL + L D +NYL KR +M Sbjct: 148 GGSHNLSYTLRDHKNYLRAKRQREM 172