BLASTX nr result
ID: Atractylodes21_contig00048409
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00048409 (356 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279295.1| PREDICTED: disease resistance protein RPS2 [... 163 1e-38 emb|CAN68181.1| hypothetical protein VITISV_013393 [Vitis vinifera] 160 8e-38 ref|XP_002514137.1| leucine-rich repeat-containing protein 2, lr... 149 2e-34 gb|AAM90858.1|AF487796_1 RPS2 [Arabidopsis lyrata] 137 1e-30 ref|XP_002869629.1| hypothetical protein ARALYDRAFT_913954 [Arab... 137 1e-30 >ref|XP_002279295.1| PREDICTED: disease resistance protein RPS2 [Vitis vinifera] Length = 903 Score = 163 bits (413), Expect = 1e-38 Identities = 84/110 (76%), Positives = 94/110 (85%), Gaps = 1/110 (0%) Frame = +2 Query: 2 LLTLLLQWNSGLSRISNGFFQFMPSLLVLDLSFTSLREIPASVGQLVELRHLDLSRTKLT 181 L TLLLQWNSGL+RI+ GFF FMP L VLDLSFTSL+EIP S+G+LVELRHLDLS TKLT Sbjct: 531 LSTLLLQWNSGLNRITVGFFHFMPVLRVLDLSFTSLKEIPVSIGELVELRHLDLSGTKLT 590 Query: 182 TLPRQLGMLQKLRHLDLQRTY-LRTIPREAINTLSQVRVLNLYYSYGSWE 328 LP++LG L KLR LDLQRT+ LRTIP EAI+ LSQ+RVLN YYSYG WE Sbjct: 591 ALPKELGSLAKLRLLDLQRTHSLRTIPHEAISRLSQLRVLNFYYSYGGWE 640 >emb|CAN68181.1| hypothetical protein VITISV_013393 [Vitis vinifera] Length = 928 Score = 160 bits (406), Expect = 8e-38 Identities = 83/110 (75%), Positives = 93/110 (84%), Gaps = 1/110 (0%) Frame = +2 Query: 2 LLTLLLQWNSGLSRISNGFFQFMPSLLVLDLSFTSLREIPASVGQLVELRHLDLSRTKLT 181 L TLLLQWNSGL+RI+ GFF FMP L VLDLSFTSL+EIP S+ +LVELRHLDLS TKLT Sbjct: 580 LSTLLLQWNSGLNRITVGFFHFMPVLRVLDLSFTSLKEIPVSIXELVELRHLDLSGTKLT 639 Query: 182 TLPRQLGMLQKLRHLDLQRTY-LRTIPREAINTLSQVRVLNLYYSYGSWE 328 LP++LG L KLR LDLQRT+ LRTIP EAI+ LSQ+RVLN YYSYG WE Sbjct: 640 ALPKELGSLAKLRLLDLQRTHSLRTIPHEAISRLSQLRVLNFYYSYGGWE 689 >ref|XP_002514137.1| leucine-rich repeat-containing protein 2, lrrc2, putative [Ricinus communis] gi|223546593|gb|EEF48091.1| leucine-rich repeat-containing protein 2, lrrc2, putative [Ricinus communis] Length = 877 Score = 149 bits (377), Expect = 2e-34 Identities = 78/119 (65%), Positives = 95/119 (79%), Gaps = 1/119 (0%) Frame = +2 Query: 2 LLTLLLQWNSGLSRISNGFFQFMPSLLVLDLSFTSLREIPASVGQLVELRHLDLSRTKLT 181 LLTLLLQ+NSGLSRI + +F MPSL VLDLS TSLRE+PAS+ +LVEL+HLDLS TK+T Sbjct: 524 LLTLLLQYNSGLSRIPDTYFLLMPSLRVLDLSLTSLRELPASINRLVELQHLDLSGTKIT 583 Query: 182 TLPRQLGMLQKLRHLDLQR-TYLRTIPREAINTLSQVRVLNLYYSYGSWEVQDSEYENE 355 LP++LG L KL+HLDLQR T LRTIP++A++ L Q+RVLN YYSY W +SE E Sbjct: 584 ALPKELGHLSKLKHLDLQRATSLRTIPQQALSGLLQLRVLNFYYSYAGWGGNNSETAKE 642 >gb|AAM90858.1|AF487796_1 RPS2 [Arabidopsis lyrata] Length = 907 Score = 137 bits (344), Expect = 1e-30 Identities = 71/112 (63%), Positives = 88/112 (78%), Gaps = 1/112 (0%) Frame = +2 Query: 2 LLTLLLQWNSGLSRISNGFFQFMPSLLVLDLSFTSLREIPASVGQLVELRHLDLSRTKLT 181 L TL+LQ NS L +IS GFF MP L VLDLSFTS+ EIP S+ LVEL HL +S TK++ Sbjct: 535 LTTLMLQRNSSLKKISTGFFMHMPILRVLDLSFTSITEIPLSIKYLVELCHLSMSGTKIS 594 Query: 182 TLPRQLGMLQKLRHLDLQRT-YLRTIPREAINTLSQVRVLNLYYSYGSWEVQ 334 LP++LG L+KL+HLDLQRT +L+TIPR+AI LS++ VLNLYYSY WE+Q Sbjct: 595 ILPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLNLYYSYAGWELQ 646 >ref|XP_002869629.1| hypothetical protein ARALYDRAFT_913954 [Arabidopsis lyrata subsp. lyrata] gi|297315465|gb|EFH45888.1| hypothetical protein ARALYDRAFT_913954 [Arabidopsis lyrata subsp. lyrata] Length = 907 Score = 137 bits (344), Expect = 1e-30 Identities = 71/112 (63%), Positives = 88/112 (78%), Gaps = 1/112 (0%) Frame = +2 Query: 2 LLTLLLQWNSGLSRISNGFFQFMPSLLVLDLSFTSLREIPASVGQLVELRHLDLSRTKLT 181 L TL+LQ NS L +IS GFF MP L VLDLSFTS+ EIP S+ LVEL HL +S TK++ Sbjct: 535 LTTLMLQRNSSLKKISTGFFMHMPILRVLDLSFTSITEIPLSIKYLVELCHLSMSGTKIS 594 Query: 182 TLPRQLGMLQKLRHLDLQRT-YLRTIPREAINTLSQVRVLNLYYSYGSWEVQ 334 LP++LG L+KL+HLDLQRT +L+TIPR+AI LS++ VLNLYYSY WE+Q Sbjct: 595 ILPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLNLYYSYAGWELQ 646