BLASTX nr result
ID: Atractylodes21_contig00048217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00048217 (336 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI16890.3| unnamed protein product [Vitis vinifera] 67 1e-09 ref|XP_002279045.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-09 emb|CAN75614.1| hypothetical protein VITISV_022293 [Vitis vinifera] 67 1e-09 ref|XP_002532893.1| pentatricopeptide repeat-containing protein,... 61 1e-07 ref|XP_003627859.1| Pentatricopeptide repeat-containing protein ... 59 4e-07 >emb|CBI16890.3| unnamed protein product [Vitis vinifera] Length = 653 Score = 67.4 bits (163), Expect = 1e-09 Identities = 35/71 (49%), Positives = 46/71 (64%) Frame = +2 Query: 122 MANLSCFTSETHLVKTVCAVVLKACSWDIILKPRIGSIITSITINQALHHLSQNGSFCFI 301 MA+L ET L K VC +V+K W+ +LKP +GS +TS +NQ L +LS +G C + Sbjct: 26 MASLVFQCGETQLAKIVCGIVVKG-HWNSLLKPNVGSNLTSTILNQVLLNLSLDG--CCV 82 Query: 302 SWNFFKWVELN 334 SW FFKWVE N Sbjct: 83 SWAFFKWVESN 93 >ref|XP_002279045.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Vitis vinifera] Length = 590 Score = 67.4 bits (163), Expect = 1e-09 Identities = 35/71 (49%), Positives = 46/71 (64%) Frame = +2 Query: 122 MANLSCFTSETHLVKTVCAVVLKACSWDIILKPRIGSIITSITINQALHHLSQNGSFCFI 301 MA+L ET L K VC +V+K W+ +LKP +GS +TS +NQ L +LS +G C + Sbjct: 1 MASLVFQCGETQLAKIVCGIVVKG-HWNSLLKPNVGSNLTSTILNQVLLNLSLDG--CCV 57 Query: 302 SWNFFKWVELN 334 SW FFKWVE N Sbjct: 58 SWAFFKWVESN 68 >emb|CAN75614.1| hypothetical protein VITISV_022293 [Vitis vinifera] Length = 590 Score = 67.4 bits (163), Expect = 1e-09 Identities = 35/71 (49%), Positives = 46/71 (64%) Frame = +2 Query: 122 MANLSCFTSETHLVKTVCAVVLKACSWDIILKPRIGSIITSITINQALHHLSQNGSFCFI 301 MA+L ET L K VC +V+K W+ +LKP +GS +TS +NQ L +LS +G C + Sbjct: 1 MASLVFQCGETQLAKIVCGIVVKG-HWNSLLKPNVGSNLTSTILNQVLLNLSLDG--CCV 57 Query: 302 SWNFFKWVELN 334 SW FFKWVE N Sbjct: 58 SWAFFKWVESN 68 >ref|XP_002532893.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527353|gb|EEF29498.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 625 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/69 (42%), Positives = 45/69 (65%) Frame = +2 Query: 122 MANLSCFTSETHLVKTVCAVVLKACSWDIILKPRIGSIITSITINQALHHLSQNGSFCFI 301 MA + SET LV+ +CA V+K W+ +L+P+I SI+T+ T++Q L+ LS + + Sbjct: 1 MAAVVTLRSETQLVQNICATVIKG-GWNNLLRPKICSILTASTLHQVLYQLSLHSQGPCL 59 Query: 302 SWNFFKWVE 328 SW FKW+E Sbjct: 60 SWALFKWIE 68 >ref|XP_003627859.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355521881|gb|AET02335.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 731 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/62 (41%), Positives = 42/62 (67%) Frame = +2 Query: 143 TSETHLVKTVCAVVLKACSWDIILKPRIGSIITSITINQALHHLSQNGSFCFISWNFFKW 322 TS HL+++VCA+++K W+ +LKP+ S +TS TI+Q + HL Q+ F ++FFKW Sbjct: 9 TSNKHLIESVCAIIVKG-DWNNLLKPKTASTLTSTTIHQVILHLKQHRYEPFFIFHFFKW 67 Query: 323 VE 328 + Sbjct: 68 AQ 69