BLASTX nr result
ID: Atractylodes21_contig00048173
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00048173 (402 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002997585.1| conserved hypothetical protein [Phytophthora... 58 9e-07 ref|XP_002905852.1| conserved hypothetical protein [Phytophthora... 58 9e-07 ref|XP_002459507.1| hypothetical protein SORBIDRAFT_02g005820 [S... 57 1e-06 ref|XP_003330858.1| hypothetical protein PGTG_12395 [Puccinia gr... 57 2e-06 ref|XP_003326920.1| hypothetical protein PGTG_08457 [Puccinia gr... 57 2e-06 >ref|XP_002997585.1| conserved hypothetical protein [Phytophthora infestans T30-4] gi|262110548|gb|EEY68600.1| conserved hypothetical protein [Phytophthora infestans T30-4] Length = 282 Score = 57.8 bits (138), Expect = 9e-07 Identities = 30/91 (32%), Positives = 48/91 (52%) Frame = -2 Query: 383 KWTDLKRKITNFNGIFLNVKSKYQSGWSDEDYIQRALSRYRAQNKNAAFSNLLAWKVVRH 204 +W ++ K+T F G++ VKS+ +SGW+DE Y+ AL Y A+ F L AW ++ Sbjct: 65 RWKKMQPKVTKFCGVYARVKSRERSGWNDEMYLDAALEIY-AERYKQPFEFLAAWNELKD 123 Query: 203 HPRWSLPELDPSLPEMDPNPRPSKKSKSTSD 111 P+W+ S D + R +K+ S D Sbjct: 124 KPKWT------SKITSDSSARAKRKAGSDGD 148 >ref|XP_002905852.1| conserved hypothetical protein [Phytophthora infestans T30-4] gi|262109152|gb|EEY67204.1| conserved hypothetical protein [Phytophthora infestans T30-4] Length = 260 Score = 57.8 bits (138), Expect = 9e-07 Identities = 32/108 (29%), Positives = 56/108 (51%), Gaps = 7/108 (6%) Frame = -2 Query: 383 KWTDLKRKITNFNGIFLNVKSKYQSGWSDEDYIQRALSRYRAQNKNAAFSNLLAWKVVRH 204 +W L+ ++T F GIF +KSK +SGW++E +++ A+S Y ++K F L AW +R Sbjct: 64 RWKKLQPEVTKFEGIFSKLKSKERSGWNEEMFVKSAVSIYGERHKQ-PFEFLDAWNELRD 122 Query: 203 HPRWSLPELDPSL-------PEMDPNPRPSKKSKSTSDSNAIRRLPMP 81 P+W+ S E P P K +K+ + ++ + +P Sbjct: 123 KPKWTQRLTTSSTTLGTKRKKEAVPRPESQKAAKAAKIAGSVGKDGLP 170 >ref|XP_002459507.1| hypothetical protein SORBIDRAFT_02g005820 [Sorghum bicolor] gi|241922884|gb|EER96028.1| hypothetical protein SORBIDRAFT_02g005820 [Sorghum bicolor] Length = 413 Score = 57.4 bits (137), Expect = 1e-06 Identities = 32/101 (31%), Positives = 53/101 (52%), Gaps = 2/101 (1%) Frame = -2 Query: 401 KDQLISKWTDLKRKITNFNGIFLNVKSKYQSGWSDEDYIQRALSRYRAQNKNAAFSNLLA 222 K QL S W + +T FNG++ + Y SG SD+ + +A + ++ +NK F+ Sbjct: 202 KGQLKSHWVRINAAVTKFNGVY--GRMTYCSGESDDMLMDKARAAFKRENKKKPFTLEYV 259 Query: 221 WKVVRHHPRW--SLPELDPSLPEMDPNPRPSKKSKSTSDSN 105 WK++R P+W S+P +D S E + + + TS SN Sbjct: 260 WKILRKEPKWFRSIPSMDCS--EKNKRTKVDESGAYTSSSN 298 >ref|XP_003330858.1| hypothetical protein PGTG_12395 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gi|309309848|gb|EFP86439.1| hypothetical protein PGTG_12395 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 315 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/101 (29%), Positives = 50/101 (49%), Gaps = 3/101 (2%) Frame = -2 Query: 395 QLISKWTDLKRKITNFNGIFLNVKSKYQSGWSDEDYIQRALSRYRAQNKNAAFSNLLAWK 216 Q+ ++WT L F+ I+ ++ SG S +D+++ A + Y+ Q K AFS+L AW+ Sbjct: 80 QIKTRWTALNTATLKFSAIYNAIERNPPSGSSPDDWLEAAKTAYQDQTKGTAFSSLSAWQ 139 Query: 215 VVRHHPRW---SLPELDPSLPEMDPNPRPSKKSKSTSDSNA 102 +R+ P+W P+ S P P +DS A Sbjct: 140 KLRYAPKWRADQRPDARVSTPSSAAAPSSDANDPDETDSTA 180 >ref|XP_003326920.1| hypothetical protein PGTG_08457 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gi|309305910|gb|EFP82501.1| hypothetical protein PGTG_08457 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 316 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/99 (31%), Positives = 48/99 (48%), Gaps = 2/99 (2%) Frame = -2 Query: 395 QLISKWTDLKRKITNFNGIFLNVKSKYQSGWSDEDYIQRALSRYRAQNKNAAFSNLLAWK 216 Q+ ++WT + F I+ ++ SG S +D+++ A + Y+ Q K AF+ LLAW+ Sbjct: 91 QIKTRWTAMNTATLKFAAIYNAIERNPPSGSSPDDWLEAAKTNYQDQTKGTAFNALLAWQ 150 Query: 215 VVRHHPRWSLPEL--DPSLPEMDPNPRPSKKSKSTSDSN 105 +RH P+W PS P P P S SN Sbjct: 151 KLRHAPKWRANACVDQPSTPRALPIPTSDSIDPKESLSN 189